KEGG   Acinetobacter baylyi: ACIAD2695
Entry
ACIAD2695         CDS       T00185                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
aci  Acinetobacter baylyi
Brite
KEGG Orthology (KO) [BR:aci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aci02044]
    ACIAD2695
Secretion system [BR:aci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ACIAD2695
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: CAG69448
UniProt: Q6F917
Position
2652825..2653928
AA seq 367 aa
MSINISELLQPITEQSPCGEDYSFSNEFHLIKKARTQDDVLLDQGDWVTELKQADWETVT
STSSNLLKTKTKDIRLLTWLSEGWANLYGFEGIYQGIELSHRLLDQFWNDIHPVVEDDDL
DQRIALLQGLINQLPLLIKKTPLINTSPYYHLLNYENFLHHQNIRRKQSDEYEQLDGPSE
IELFEQALFNTSKSFQYQNYQMFKHVVSQWQQLKDVLDRLMGVDAPSFAAIDSSLQDIDV
NLRKIYKAEAFDTNPVATSSATASSHASETLSTEPMPTSNVNVNQPSFQPQTQNHIQNRE
QAIRVLQDISDYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQLVQEALGV
QPKNEYE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagtataaacatttcagagttgttacagccaattactgaacaatctccatgtggagag
gattactcattttccaatgaatttcatctgatcaaaaaagccagaacacaagatgatgtc
ttacttgatcagggcgattgggtcactgaattgaaacaggctgattgggaaacagtgacc
agtacctcatcaaacctattaaaaacaaaaaccaaggatattcgcttacttacttggctg
agtgaaggatgggctaatctatatggatttgaaggtatttatcagggcattgaattaagt
catcgtttactggatcaattctggaatgacatccatcctgtggtagaagatgatgatctg
gatcaaagaatcgcattgttacagggcttaattaatcaactgcccttactcatcaagaaa
acacctttaattaatacgtcgccttattatcatttgctcaattacgaaaattttttacat
catcagaatattcgacgtaagcaaagcgacgagtatgaacagttagatggtccctctgaa
atcgaactatttgaacaagctttatttaatacatcaaaaagttttcaatatcagaattat
caaatgtttaagcatgttgtatctcaatggcaacagcttaaggatgtactggatcgcctg
atgggagtggatgctccaagtttcgcagcaattgattccagcctgcaagatattgatgtc
aatctccgtaaaatttataaagccgaagccttcgatacaaatccagtagcaacttcatcg
gctacagcttctagccatgcttctgaaacattgagtaccgagcctatgcctacctcaaat
gtcaatgtaaaccagccgagctttcaaccgcaaacccaaaatcacattcaaaatcgtgaa
caagcgattcgggtattgcaagatatttctgactactttcaggcaaatgagcctcatagt
cccgtcagttatatgctgcaaaaaacgattaaatggagccagatgccattacatgaatgg
ttagcacaagtcattaaagatgagcatccgttacagttggtacaagaagctcttggtgta
caacctaaaaatgaatatgaataa

DBGET integrated database retrieval system