KEGG   Acinetobacter sp. ADP1: ACIAD2852Help
Entry
ACIAD2852         CDS       T00185                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00790  Folate biosynthesis
aci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACIAD2852 (folP)
Enzymes [BR:aci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ACIAD2852 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF2802 F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: CAG69582
UniProt: Q6F8N3
Position
complement(2788851..2789702)
Genome map
AA seq 283 aa AA seqDB search
MHLSPLPQKQLKCGSYLLDLSEPQVMGILNVTPDSFSDGGQHHQKEKAYAHAMQMIGDGA
SIIDIGGESTRPGASSVEIEEEIRRVVPVVEMLSKEKIILSIDTSQPEVIKAAIEAGAHI
WNDVRALTRPQAIETAAQLDIPVIIMHMRGEPTTMNQLDQYGDVVAEVMHELSQRIQDAL
DHGIRVENIVVDPGFGFAKNAGQNLKLLNELWKFNAMGYPILSGLSRKRFIGEALQGATA
DQRAIGSVAGHLISLQQGASIVRVHDVKAMVDAIRVWQAALNA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaagccctttgcctcaaaaacaattgaaatgtggatcatatttacttgattta
tctgagccacaggtcatggggattttaaatgtaacaccagactcgtttagcgatggtgga
cagcatcatcaaaaagagaaagcatatgcacatgccatgcaaatgattggtgatggtgca
tctattattgatattggtggagaatcgacacgtccaggcgcatcctctgttgagattgag
gaagaaatacgacgtgtagtaccagtggtggagatgctatctaaagagaaaatcatcttg
tcaattgataccagccagccagaagtgattaaagctgccatagaagcaggtgcgcatatt
tggaatgatgtaagggcattaacccgccctcaggcgattgaaacagcagcacaacttgat
attcctgtcatcatcatgcatatgcgtggcgaacccactaccatgaatcaattagatcag
tatggcgatgttgttgcagaggtgatgcatgagttaagtcagcgtattcaagacgcactt
gatcatggaatacgagttgaaaatattgtggttgatcctggttttggttttgcaaagaat
gctgggcagaatttaaaacttttaaacgagttatggaagtttaatgcaatggggtatccg
atactctctggtttatcccgaaaacgttttattggtgaagccttacaaggagcgaccgcc
gatcagcgtgctattggtagcgtagcagggcatctgataagcctacaacaaggtgcttca
atcgtcagggttcatgatgtcaaggctatggtagatgcaatacgcgtttggcaagcagca
ctcaatgcctga

DBGET integrated database retrieval system