KEGG   Acinetobacter sp. ADP1: ACIAD2873Help
Entry
ACIAD2873         CDS       T00185                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00020  Citrate cycle (TCA cycle)
aci00640  Propanoate metabolism
aci00660  C5-Branched dibasic acid metabolism
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01200  Carbon metabolism
Module
aci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACIAD2873 (sucC)
   00640 Propanoate metabolism
    ACIAD2873 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ACIAD2873 (sucC)
Enzymes [BR:aci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ACIAD2873 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Ribosomal_L12
Motif
Other DBs
NCBI-ProteinID: CAG69601
UniProt: Q6F8L4
Position
complement(2813447..2814613)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALLKKYGVSVQEGILARSAEEAVAAFEQLGGKFAVIKAQVHAGGRGKAGGV
KVVKSKEEAADYANQLIGTNLVTYQTDANGQPVNSVLVCEDVYPVERELYLGAVVDRSSR
RVTFMASTEGGVEIEKVAEETPEKIIKVEVDPLVGLQPFQAREVAFALGLKDKQIGQFVK
LMAGAYQAFVENDFALFEINPLSVRENGDILAVDAKIGIDSNALYRLPEIAASRDKSQEN
ERELKASEFELNYVALEGNIGCMVNGAGLAMATMDIIKLYGGQPANFLDVGGGATKERVI
EAFKLILADTSVQGVLINIFGGIVRCDMIAEAIIAAVQEVNVTVPVVVRLEGNNAELGAK
ILDESGLKLTSANGLSDAAEKIVAAVKG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaagccaaagcactgttgaaaaaatatggagtgtctgtccaa
gaaggaattttggcaagaagtgcagaagaagcagtcgctgcatttgaacaattaggtggc
aaatttgctgtgatcaaagcgcaggtacatgcgggtggtcgtggtaaggcaggtggtgta
aaagttgttaaatcaaaagaagaagccgctgattatgcaaaccagttgattggtaccaat
cttgtgacctatcagacggatgcgaatggacaaccagtcaatagcgtccttgtttgcgaa
gatgtatatcctgttgagcgtgaactgtatctcggtgctgtggtcgaccgttcctcacgc
cgtgtgacgttcatggcatccactgaaggtggggtggaaattgagaaagttgctgaagaa
acaccagaaaaaattatcaaagttgaagtggatccacttgtaggtttacaaccgtttcaa
gcgcgtgaagttgcttttgcattaggtttaaaagacaagcagattggtcagtttgtcaag
ctgatggcaggtgcttatcaggcattcgttgaaaatgattttgccctatttgaaatcaac
ccactctcagttcgtgaaaacggcgatattcttgcagtcgatgctaaaattggaatcgat
tcaaatgcattgtaccgtttgcctgaaatcgcagcatctcgtgacaagtcacaagaaaac
gagcgtgaattaaaagcgtctgagtttgaactgaattacgttgcgcttgaagggaatatt
ggttgtatggtcaatggtgctggtctggctatggcaaccatggacattattaaactttat
ggcggtcaacctgcaaacttccttgacgtaggtggtggtgcaaccaaagagcgtgtaatt
gaagcgtttaaactcattttagccgatacatctgtacaaggtgtattgattaatatcttc
ggtggaattgtgcgttgtgacatgattgctgaagcaattattgcagcagttcaagaggtt
aatgtgactgttcctgttgttgtccgtttagagggtaataatgcagaactaggcgcaaaa
attctcgatgaatctggtttaaaacttacttctgctaatggtttatccgatgcggcagaa
aaaattgttgctgcagtgaaagggtaa

DBGET integrated database retrieval system