KEGG   Acidilobus sp. 7A: SE86_04115Help
Entry
SE86_04115        CDS       T05595                                 

Definition
(GenBank) hypothetical protein
  KO
K18978  glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+] [EC:1.2.1.90]
Organism
acia  Acidilobus sp. 7A
Pathway
acia00010  Glycolysis / Gluconeogenesis
acia00030  Pentose phosphate pathway
acia01100  Metabolic pathways
acia01120  Microbial metabolism in diverse environments
acia01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE86_04115
   00030 Pentose phosphate pathway
    SE86_04115
Enzymes [BR:acia01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.90  glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+]
     SE86_04115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh RP1-2 YCII
Motif
Other DBs
NCBI-ProteinID: AMD30644
UniProt: A0A0X8IBQ2
Position
complement(819948..820382)
Genome map
AA seq 144 aa AA seqDB search
MDAVSKGGRVLHGGKKVEELGPNYIKPTLIEVDASRLPELYMYNKEVFASIAAIVKVRDL
DEAIALANGRRYGLDAAIFGSDLSKIRRAARQLEVGAVYINNYPFGGMKDSGIGREGIGY
TIDFVTAYKSIVYNYKGRGVWDYL
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtgtcaaagggcggcagggtgctccacggcgggaagaaggttgaggagctg
ggccctaactacataaagcccactctcatagaggttgacgcctcgaggctgccggagctc
tacatgtacaacaaggaggtgttcgcctccatagcagctatagttaaggtcagggacctc
gacgaggccatagcccttgccaacgggaggaggtacggccttgacgcggcgatattcggc
agcgacctctcaaagataaggagggcggccaggcagcttgaggtgggggccgtctacatc
aacaactaccccttcggcggcatgaaggactcaggcatagggagggagggcatagggtac
accatagacttcgtcaccgcctacaagtctatagtgtacaactacaagggcaggggcgtg
tgggactacctctaa

DBGET integrated database retrieval system