KEGG   Acidovorax carolinensis NA2: CBP33_00580Help
Entry
CBP33_00580       CDS       T04914                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00071  Fatty acid degradation
acid00072  Synthesis and degradation of ketone bodies
acid00280  Valine, leucine and isoleucine degradation
acid00310  Lysine degradation
acid00362  Benzoate degradation
acid00380  Tryptophan metabolism
acid00620  Pyruvate metabolism
acid00630  Glyoxylate and dicarboxylate metabolism
acid00640  Propanoate metabolism
acid00650  Butanoate metabolism
acid00900  Terpenoid backbone biosynthesis
acid01100  Metabolic pathways
acid01110  Biosynthesis of secondary metabolites
acid01120  Microbial metabolism in diverse environments
acid01130  Biosynthesis of antibiotics
acid01200  Carbon metabolism
acid01212  Fatty acid metabolism
acid02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBP33_00580
   00630 Glyoxylate and dicarboxylate metabolism
    CBP33_00580
   00640 Propanoate metabolism
    CBP33_00580
   00650 Butanoate metabolism
    CBP33_00580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBP33_00580
   00072 Synthesis and degradation of ketone bodies
    CBP33_00580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBP33_00580
   00310 Lysine degradation
    CBP33_00580
   00380 Tryptophan metabolism
    CBP33_00580
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBP33_00580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBP33_00580
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBP33_00580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acid04147]
    CBP33_00580
Enzymes [BR:acid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBP33_00580
Exosome [BR:acid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBP33_00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SnoaL_4 ACP_syn_III PTA_PTB
Motif
Other DBs
NCBI-ProteinID: ART46819
UniProt: A0A2C9NTG2
Position
complement(123890..125098)
Genome map
AA seq 402 aa AA seqDB search
MRRVAIVTPVRTPVGTFGGSLRPVPVEELATTTVRAVVERSGIDPARIDDVVMAQSYANS
EVPCVGRWAALQAGLPVSVPGMQLDRRCGGGLQAIVTAAMMVQSGAADVVIAGGVESMSN
IEYYSTDMRWGARSGNVRFFDRLERGRERSQPVERFGKISGMIETAENLARDYGITREEA
DAYAVRSHQRTAAAWAAGRFNDEIVPVQVPQRKGDPVVFSKDEGFRADVTAESLGKLRVL
MPNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLVGWAAAGCEPSHMGIGPVPA
VKKLLARLNLKIDDMDLVELNEAFACQVLSVLKGWEWQDQDAIAHKLNVNGSGISLGHPI
GATGVRILATLLHELQRRKGRYGLETMCIGGGQGIAAVFERA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagagtcgccatcgtcacccctgttcgtacccccgtcggcaccttcggcggcagc
ctgaggcccgtgcccgtggaggagctggccaccaccacggtgcgcgccgtggtcgagcgc
agcggcatcgaccccgcgcgcatcgacgacgtggtcatggcccagtcctacgccaacagc
gaggtgccttgcgtgggccgctgggccgcgctgcaggcgggtttgccggtgtcggtgccg
ggcatgcagctcgataggcgctgcggcggcggcctgcaggccatcgtcacggccgcgatg
atggtgcaaagcggcgccgccgatgtggtgattgccggcggcgtggagagcatgagcaac
atcgagtactacagcaccgacatgcgctggggcgcgcgctcgggcaacgtgcgctttttt
gaccgcctggagcgcggccgcgagcgctcgcagccggtggagcgcttcggcaagatctcg
ggaatgatcgagacggcagagaacctggcgcgcgactacggcatcacgcgcgaggaggcc
gatgcctacgccgtgcgcagccaccagcgcacggcggccgcctgggccgcggggcgcttc
aacgatgaaatcgtccccgtgcaggtaccccagcgcaagggcgacccggttgttttcagc
aaggacgaaggctttcgcgccgatgtgacggccgagagcctgggcaagctgcgcgtgctg
atgcccaacggcaccgtcactgccggcaacgccagccagcaaaacgatgccagcgctgcc
tgcctgatcgttgccgaggacaaactggccgaactgggtctgacgcccatggccaccctg
gtgggctgggcggcggcgggctgcgaaccctcgcacatgggcatcggcccggttccggcc
gtcaaaaagctgctggcgcgcctgaacctcaagatcgacgacatggacctggtggagctt
aacgaggcctttgcctgccaggtgctgtccgtgctcaagggctgggaatggcaggaccag
gatgccatcgcgcacaagctcaacgtcaacggctcaggcatctcgctgggccaccccatc
ggcgccaccggcgtgcgcatcctggccactctgctgcacgaactgcagcgccgcaagggc
cgctacgggctggagacgatgtgcattggcggcggccagggcattgcggcggtgttcgaa
cgggcgtaa

DBGET integrated database retrieval system