KEGG   Acidovorax carolinensis NA2: CBP33_00895Help
Entry
CBP33_00895       CDS       T04914                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00480  Glutathione metabolism
acid00590  Arachidonic acid metabolism
acid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CBP33_00895
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP33_00895
Enzymes [BR:acid01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CBP33_00895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ART46871
UniProt: A0A240TP13
Position
complement(193006..193500)
Genome map
AA seq 164 aa AA seqDB search
MPSLYDFEALPMSGPAVPLRQFEGKVLLIVNTASACGFTPQFGGLEELHKQYGDKGLVVL
GFPCNQFGRQDPGSNDEIASFCQLNYGVSFPMMAKIDVNGANASPLYQWLTAEAPGLLGS
KAIKWNFTKFLVGRDGRVIRRYAPQDAPKKLAADIEEALAAPAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcctctacgacttcgaagccctgcccatgagcgggcccgccgtgccgctgcgg
cagtttgagggcaaggtattgctgatcgtcaacacagccagcgcctgcggcttcaccccg
cagttcggcgggctggaagaactgcacaagcagtacggcgacaaggggttggtggtgctg
ggttttccgtgcaaccagttcggccgccaggacccgggcagcaacgacgagatcgccagc
ttctgccagctcaactatggcgtgagctttccgatgatggccaagatcgacgtgaacggc
gccaacgcctccccgctgtaccagtggctcaccgccgaagcccctggcctgctgggcagc
aaggccatcaagtggaacttcacgaagttcctcgtgggccgggacggccgcgtgatccgc
cgctatgcgccacaggatgcgccgaaaaagctggcagcggatatcgaggaggcgctggcc
gcccccgccgcataa

DBGET integrated database retrieval system