KEGG   Acidovorax carolinensis NA2: CBP33_04265Help
Entry
CBP33_04265       CDS       T04914                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00450  Selenocompound metabolism
acid00970  Aminoacyl-tRNA biosynthesis
acid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CBP33_04265
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CBP33_04265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acid01007]
    CBP33_04265
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acid03016]
    CBP33_04265
Enzymes [BR:acid01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CBP33_04265
Amino acid related enzymes [BR:acid01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CBP33_04265
Transfer RNA biogenesis [BR:acid03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CBP33_04265
 Prokaryotic type
   Other AARSs
    CBP33_04265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ART47430
UniProt: A0A240TQM9
Position
complement(896841..898925)
Genome map
AA seq 694 aa AA seqDB search
MSSARKLFVTTALPYANGNFHIGHIMEYIQADIWVRTQRLLGNAVNFVGADDTHGAPIMI
AAEKAGKTPQQFVADIAAGRKQYLDGFHIEFDNWHSTDAPENHQLAQDIYRDLKANGLIE
TRTIEQFFDPEKNMFLPDRFIKGECPKCHAKDQYGDNCEVCGAVYAPTDLINPYSALSGA
KPLLKSSEHFFFKLSDPRCVAFLEDWTQNGRLQPEVANKVREWFTVRTNPDGSTSEGLGD
WDISRDAPYFGIEIPDAPGKYFYVWLDAPIGYLASLKNLLDKRGEDYDAYMADPQLEQYH
FIGKDIVTFHTLFWPATLKFSGRKVPDSVFVHGFLTVNNGEKMSKSRGTGLDPLKYLGLS
MNAEWLRYYLATKLSSRNEDIDFNADDFMARVNSDLIGKYINIASRAAGFIAKRFGGALG
EVSADGDALLDHLRTVTPSIIELLAEREYGKALRETMLLADRVNTYVDQNKPWELAKQDG
MEGRLQDVCTTCIEAFRLLTILLKPVLPALAAQVEAFLKVQPFTFADATTMLGKGHVIGE
YKHLMQRVDAKQLEALFEPPVQAESAQSATENVAPGGEELAPTITIDDFTKIDLRIALIV
NCEAVEGSTKLLRLTLDVGEGKTRNVFSGIASAYQPADLIGKHTVMVANLAPRKMKFGVS
EGMVLAASHGDEKANPGIYVLNPWPGATPGMRVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgcacgcaaactttttgtcaccaccgccctgccctacgccaatggcaacttc
cacatcggccacatcatggaatacatccaggccgacatctgggtgcgcacgcagcggctg
ctgggcaacgcggtgaacttcgtcggcgccgacgacacgcacggcgcgccgatcatgatc
gccgccgaaaaggccggcaagacgccccagcagttcgtggccgacatcgccgccgggcgc
aagcagtacctcgatggctttcacatcgaattcgacaactggcacagcaccgacgcgccc
gaaaaccaccagctggcgcaagacatctaccgtgacctcaaggccaacggcctgatcgaa
acgcgcaccatcgagcagttcttcgaccccgagaagaacatgtttctgcccgaccgcttc
atcaaaggcgaatgccccaaatgccatgccaaggaccagtacggcgacaactgcgaggtc
tgcggcgccgtctacgcgcccaccgacctgatcaacccctactcggcactgtcgggcgcc
aagccgctgctcaaaagctcggagcatttcttcttcaagctgtcggacccgcgctgcgtg
gcatttctggaagactggacacaaaacggccgcctgcagcccgaagtggccaacaaggtg
cgcgaatggttcaccgtgcgcaccaaccccgacggcagcaccagcgagggcctgggcgac
tgggacatctcgcgcgacgccccctacttcggcatcgagatccccgacgcaccgggcaaa
tacttctatgtgtggctcgatgcgcccatcggctatctcgcctcgctgaaaaacctgctt
gacaagcgcggcgaggactacgacgcctacatggccgacccgcagctggagcagtaccac
ttcatcggcaaggacattgtcaccttccacaccctgttctggccggccacgctcaaattc
agcgggcgcaaggtgcccgattcggtgttcgtgcacggcttcctcacggtgaacaacggc
gagaaaatgagcaagagccgcggcacaggcctggacccgctcaagtacctgggcctctcc
atgaacgccgagtggctgcgctactacctggccaccaagctcagcagccgcaacgaggac
atcgacttcaatgccgacgacttcatggcccgcgtcaacagcgacctgatcggcaagtac
atcaacatcgcctcgcgcgcggccggttttatcgccaagcgctttggcggggcgctgggc
gaggtgtcagccgacggcgacgcgctgctggaccacctgcgcaccgtgacaccctccatc
atcgagctgctggccgagcgcgaatatggcaaggccctgcgcgagaccatgctgctggcc
gaccgcgtgaacacctacgtggaccagaacaagccctgggaactggccaagcaggacggc
atggaaggccgcctgcaggacgtgtgcaccacctgcatcgaggcgttccgcctgctcacc
atcctgctcaagccggtgctgccggcgctggccgcgcaggtcgaggctttcctgaaggtg
cagcccttcacgtttgccgacgccaccaccatgctcggcaagggccatgtgatcggtgaa
tacaagcacctgatgcagcgcgtggatgccaaacagcttgaagcattgtttgagccccca
gtccaggcagaatcagcgcaatcagctacagaaaacgtagcgcccggcggcgaggagctg
gcccccaccatcaccatcgacgacttcaccaagatcgatctgcgcattgcgctgatcgtg
aattgcgaggccgtggagggctcgaccaagctgctgcgcctgacgctggatgtgggcgag
ggcaaaacccgcaacgtgttcagcggcatcgccagcgcctaccagcccgccgacctgatc
ggcaagcacaccgtgatggtggccaacctggcgccgcgcaagatgaagtttggcgtgagc
gaaggcatggtgctggccgcgagccatggtgacgagaaggcgaaccccggcatctacgtg
ctcaacccctggccaggcgccacgccgggcatgcgcgtgcgctga

DBGET integrated database retrieval system