KEGG   Acidovorax carolinensis NA2: CBP33_05390
Entry
CBP33_05390       CDS       T04914                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00626  Naphthalene degradation
acid01100  Metabolic pathways
acid01120  Microbial metabolism in diverse environments
acid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CBP33_05390
Enzymes [BR:acid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CBP33_05390
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ART47625
UniProt: A0A240U196
Position
1137320..1138318
AA seq 332 aa
MGKSGLLNASDIHGVWSILPTPSKPDASDWRATNTVDLDETARAVEGLIAAGANGILSMG
TLGECESLTWEEKKVFMQTIVETARGRVPVFVGTTTLNTRDTIEQTRYAHSIGADGTMLG
IPMWCNPCVDMAVQYYKDVAEAVPEMNIAIYANTEAFKFDFPRAFWARVSEIRQVVAAKY
IGIEFLLQDLHLTKHRMKLLPLDYQYYAAARMDDFVDAFWSSGTVCGPLVSTTLRDKVIA
ARRTKDWTDAHAFQGRLVKTAAPFPEDSFKTFSIYNVALEKGRIDAAGWMNAGPVRPPYN
DICPASYLDSWKASGQRWAELHKQLETESSGK
NT seq 999 nt   +upstreamnt  +downstreamnt
atgggtaagtcaggactgttgaatgcatcggatattcatggagtatggtcaattcttccg
acaccatccaaaccggatgcgagtgactggcgtgcgactaacaccgttgatctggatgag
actgcccgcgccgttgaaggccttatcgcggctggcgcgaacgggattctgagcatgggt
actttgggtgagtgtgaatcgctaacctgggaggaaaagaaagtcttcatgcaaaccatc
gtggagaccgcgagaggaagggttccagtgttcgttggcaccacaacgcttaatacccgc
gacacgatcgagcagacaaggtacgcccactccattggggccgacggaacaatgttggga
ataccaatgtggtgcaatccctgcgttgatatggctgttcagtactacaaagatgtcgcc
gaagctgttccagagatgaatatcgctatctacgcgaataccgaggctttcaaatttgat
tttccccgcgcgttctgggctcgggtttcagagattcggcaagtcgttgcagcgaaatat
atcggtatcgagttcctgctgcaggatctacatctgaccaagcaccgcatgaagctgctg
ccgctcgactaccaatactatgctgcggcacgtatggatgacttcgttgatgccttctgg
tccagcggtaccgtgtgcgggccattggtttccacgacgcttcgcgacaaggtcatcgca
gctcggcgaaccaaagactggaccgatgcccacgcatttcagggtcgacttgtgaaaaca
gctgcgccatttcccgaagatagcttcaagaccttttctatttacaacgttgcgctggaa
aaaggccgaatcgatgctgcaggctggatgaacgccggccccgttcgcccaccttataac
gacatctgcccagccagctatcttgactcctggaaagcctcagggcaacggtgggccgaa
ttgcacaagcaacttgaaacggaatcttcggggaaatag

DBGET integrated database retrieval system