KEGG   Acidovorax carolinensis NA2: CBP33_06455Help
Entry
CBP33_06455       CDS       T04914                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
acid  Acidovorax carolinensis NA2
Brite
KEGG Orthology (KO) [BR:acid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acid03016]
    CBP33_06455
Enzymes [BR:acid01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CBP33_06455
Transfer RNA biogenesis [BR:acid03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CBP33_06455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ART47813
UniProt: A0A240TRP6
Position
complement(1374584..1375450)
Genome map
AA seq 288 aa AA seqDB search
MRAFRSALHLRPAVFAPAPTPMPPLHILWRDEHLVAVYKPAGWLVHRTGLDAGETRFVMQ
TLRDQLGQHVYPVHRLDKGTCGVLVMALHSAAARALSQAFEHGATHKRYLAMVRGWAPES
IDVDHALKPDDAPADAAVQDAHTRFRRLAQLTLPEPSDARFATTRVSLVEAVPTTGRRHQ
IRRHLKHLAHPIIGDATHGKGPLNRWWAERLGQQRLWLHAWQLTVPHPVTGAALALASGL
QWPTRNTASATALNIANAAQVDHGAAAPAADWQRLLAGLPWQTAPGTR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttccgttctgcattgcaccttcgccccgccgtcttcgccccagcgcccacg
cccatgccccctttgcacatcctctggcgcgacgagcacctcgtggccgtttacaagccc
gctggctggctggtgcaccgcacgggcctggatgcgggcgagacacgctttgtgatgcag
accctgcgcgaccagctcggccagcatgtctacccggtgcaccgcctcgacaagggcacc
tgcggcgtgctggtgatggcgctgcacagcgctgcagcgcgcgcgctgtcgcaggctttc
gagcatggggcgacgcacaaacgctatctggccatggtgcgcggctgggcgcccgaatcc
atcgacgtggaccacgccctcaagcccgacgacgcccctgccgatgccgccgtgcaggac
gcccacacgcgctttcgccgcctggcacagctcacgctgcccgagcccagtgacgcccgc
tttgccaccacgcgcgtatcgctggtggaggccgtgcccaccaccgggcggcgccaccag
atccggcgccacctcaagcacctggcgcaccccatcattggtgatgccacgcacggcaaa
gggccgctgaaccgctggtgggccgagcggctgggccagcaaagactgtggctgcacgcc
tggcagctgaccgtgccacacccggtgacgggcgctgccctggcgctggccagcggcctg
cagtggcccacgaggaacaccgccagcgccactgccttgaatatcgcaaatgccgcgcaa
gtggaccacggcgcggccgcccctgcggcagactggcagcggctgctggccgggctgccc
tggcaaaccgcgcccggcacacggtag

DBGET integrated database retrieval system