KEGG   Acidovorax carolinensis NA2: CBP33_17330Help
Entry
CBP33_17330       CDS       T04914                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
acid  Acidovorax carolinensis NA2
Brite
KEGG Orthology (KO) [BR:acid00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CBP33_17330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ART49663
UniProt: A0A240TWX9
Position
3691998..3692405
Genome map
AA seq 135 aa AA seqDB search
MPKYQFDVQVAPEYLPEQSSPSSGVFRFAYTITITNAGEAPAQLISRHWIISDARGHTEE
VKGLGVVGQQPLLKPGQSFQYTSGCSLRAASGTMHGTFHCVADDGEPFSCPIPLFVLEAT
HPGASNQPVSARVLH
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaataccagtttgatgtgcaagtggcgccagagtacctgccggagcagtcctcc
cccagctccggtgtctttcgttttgcctacaccatcaccatcaccaatgcgggtgaagca
cccgcgcaactgatctcgcgccactggatcatcagtgatgccaggggccacaccgaagag
gtcaagggcctgggcgtggtgggccagcagcctttgctcaagccgggacaatcgtttcag
tacaccagcggatgcagtctgcgcgccgccagcggaaccatgcatggcacgttccattgc
gtcgctgatgacggtgagccgttcagctgcccaatacccttgtttgtgctggaggcgacc
caccccggcgcttccaaccagccggtgagcgcaagggtgctgcattga

DBGET integrated database retrieval system