KEGG   Acidiferrobacter sp. SPIII_3: C4901_00710Help
Entry
C4901_00710       CDS       T05469                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
acii  Acidiferrobacter sp. SPIII_3
Brite
KEGG Orthology (KO) [BR:acii00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C4901_00710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AWP24838
UniProt: A0A2Z3R4B9
Position
complement(135388..135768)
Genome map
AA seq 126 aa AA seqDB search
MSKSEHRIEVGVKTAYLDNQSAPEANRYVFAYTITITNTGSVPARLLTRHWIITDANNKV
QEVRGDGVVGEQPYLEPGMSFEYTSGAMIETPVGSMRGSYQMVADDGTCFDADIPAFSLS
IPRTLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagcgagcatcgcatcgaggtgggcgtaaagaccgcctatctggacaaccag
tcggcccccgaggccaaccgctacgtctttgcctacacgatcacgatcaccaataccgga
tcggtgccggcgcggctgctgacacgtcactggatcatcaccgacgccaacaacaaggtc
caggaggtgcgtggcgacggggtggtcggcgaacagccctacctggagcccggcatgagc
ttcgaatacacaagcggcgcgatgatcgagacgcccgtagggagcatgcgcgggagctac
cagatggtggccgacgacgggacatgcttcgatgccgacatcccggcattctccttgagc
atcccgcgcacattgcattag

DBGET integrated database retrieval system