KEGG   Acidiferrobacter sp. SPIII_3: C4901_01335Help
Entry
C4901_01335       CDS       T05469                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
acii  Acidiferrobacter sp. SPIII_3
Pathway
acii00860  Porphyrin and chlorophyll metabolism
acii01100  Metabolic pathways
acii01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acii00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C4901_01335 (hemN)
Enzymes [BR:acii01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     C4901_01335 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AWP22162
UniProt: A0A2Z3R420
Position
260644..262017
Genome map
AA seq 457 aa AA seqDB search
MNDSFDASLVARYGESAPRYTSYPPATQFHGQFGPDDLGRTLAARPADRPWSLYVHVPFC
ESVCYYCACNKTITKHHDRAGPYVARVARELALLSPWLGARPPLDQLHWGGGTPTFLSHD
EMRALMCAIAERFALRADDGGEYSIEIDPRHASDATLALLRSIGFNRLSLGVQDFDPAVQ
LAINREQSFALVRHVAQTARSLGFRSLSVDLIYGLPRQTRDSFARTVDRLLEIAPDRVSL
FNYAHLPERFKPQRRINAAEIPDGLTKIAILSGTAEALAGAGYVYIGLDHFAKAGDELAQ
AQRDRTLARNFQGYSTRGHLDVLGVGASAVSRIGAIYSQNAWDLKEYEALIDQGTLPVRR
GFELSADDELRREVINDLLCHMQCDVAAVEARYGLRFATYFASELARLEPFIHDGLVEMD
SRRITVTARGQMLVRAVCAVFDRYLLIADRRRFSRVV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattctttcgatgcctcgctcgtcgcccgctatggggaatcggcgccgcgttac
acctcgtaccccccagcgactcaattccatggccagttcggcccagatgacctgggccgc
acgctcgcggcgcgaccggcggatcgcccgtggtcgctctatgtgcacgtcccgttctgc
gagtccgtatgctattactgcgcctgcaataagacgataacgaagcaccacgaccgcgcc
gggccttatgtggcgcgcgtcgcccgggagctcgccttgttgtcgccatggctcggcgcg
cgcccacccctggatcagctccactggggcggcgggacgcccacctttctgagtcatgac
gagatgcgcgccctcatgtgcgcgatagccgagcgtttcgcgctgcgcgccgatgatggc
ggcgagtattcgatcgagatcgatccgcgccatgcctcggatgccacgctcgcgctcctg
cgctccatcggattcaaccgcctgagcctcggcgtccaggatttcgatcccgcggtgcag
ctcgccatcaatcgcgagcagtccttcgcgctggtgcgccatgtcgcgcagaccgcgcgc
tcgctcgggtttcggtccttgagtgtcgacctcatctatggcctgccgcgccagacccgc
gacagcttcgcacgcacggtcgatcgtctcctcgagatcgcaccggaccgcgtgtcgctc
ttcaactatgcgcatctcccggaacgcttcaaaccgcagcggcgcatcaatgccgccgag
atccccgacggcctgaccaagatcgccatcttgagcggcactgccgaggcattggcgggc
gccggctacgtctacatcgggctcgaccacttcgccaaggccggcgacgagctggcgcag
gcccagcgcgaccgcaccctggcgcgcaattttcagggatattcgacccgtgggcacctc
gatgtcctgggcgtgggggcctcggcagtcagccgcataggcgcgatctacagccagaat
gcctgggacctgaaggaatacgaggccctcatcgatcaagggacgctgcccgtgcgccgc
gggttcgaattgagcgccgatgacgagctgcgccgcgaggtgatcaacgatctcttgtgc
cacatgcagtgcgacgtggcggccgtcgaggcccgttacggcctgcgcttcgccacctat
ttcgcctccgaactggcgcgcctcgagccctttatccatgacggcctggtggagatggac
agccgcaggatcacggtgaccgcgcgcggccagatgctggtgcgcgcggtgtgcgcggtc
ttcgatcgctacctgctcatcgccgatcgccggcggttttcccgcgtcgtctag

DBGET integrated database retrieval system