KEGG   Acidiferrobacter sp. SPIII_3: C4901_05340Help
Entry
C4901_05340       CDS       T05469                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
acii  Acidiferrobacter sp. SPIII_3
Pathway
acii00480  Glutathione metabolism
acii00590  Arachidonic acid metabolism
acii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acii00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C4901_05340
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C4901_05340
Enzymes [BR:acii01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C4901_05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AWP22838
UniProt: A0A2Z3QY09
Position
complement(1025475..1025984)
Genome map
AA seq 169 aa AA seqDB search
MSAPAPAVLPLYDQRVRTAEGGMQDLGAYRGHVLLIVNVASGCGFTPQYAGLERLYRRYR
EQGLVVLGFPCNQFGGQEPAADAEIQAFCRQHYDVTFPVFAKIEVNGAHADPLFQWLSAR
APGLLGTRAIKWNFTKFLVDRGGQVLGRYAPRTRPEALVRPLERALRSP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcccgccccggccgtcctcccgctttatgatcaacgggtgcggaccgccgaa
ggcggcatgcaggatctgggcgcctaccgcggccacgtgctgctcatcgtcaacgtggcc
agcggctgcggattcacaccgcaatacgcggggctcgagcggctctaccggcgttaccgc
gagcagggcctcgtcgtcctgggctttccgtgcaaccagttcgggggccaggagccggcg
gccgatgccgagatccaggccttctgccgacaacactacgatgtcacgtttccggtgttc
gccaagatcgaggtcaacggcgcgcacgccgacccgctctttcagtggctgagcgcacgc
gcccccggcctgctcggcacgcgcgccatcaagtggaacttcaccaagttcctcgtggat
cgtggcggccaggtgctcgggcgttacgccccgcgcacccgccccgaggccctggtgcgt
cccctggagcgcgccctgagatcgccgtga

DBGET integrated database retrieval system