KEGG   Acidiferrobacter sp. SPIII_3: C4901_08680Help
Entry
C4901_08680       CDS       T05469                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
acii  Acidiferrobacter sp. SPIII_3
Pathway
acii00230  Purine metabolism
acii00250  Alanine, aspartate and glutamate metabolism
acii01100  Metabolic pathways
Module
acii_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:acii00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C4901_08680
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C4901_08680
Enzymes [BR:acii01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     C4901_08680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AWP23394
UniProt: A0A2Z3R0G7
Position
1739036..1740331
Genome map
AA seq 431 aa AA seqDB search
MAKNIVVIGTQWGDEGKGKIVDLLTERASAVVRFQGGHNAGHTLVISGQKTVLHLIPSGI
LRRDVRCYIGNGVVLAVGPLFDEVVALERAGVPVLDRLKISDACPLILPHHIALDVARER
ARGAAAIGTTGRGIGPAYEDKVSRRGLRLGDIFDETSFAAKLKDVMAYHNFTLEHFFHAP
TVSYEDTLAEIMGYRDRLAKICCDVPEALDAHKARGESLLFEGAQGTFLDIDHGTYPFVT
SSNTSAGAAATGSGVGPHVLHYVLGITKAYATRVGAGPFPTELFDAVGDRLGDRGQEFGA
TTGRKRRCGWFDAVAVRRARQINGFSGLCITKLDVLDGLDTVKICVAYEVDGKRRGTPPA
AAETLARCQPVYEEMPGWGESTVGIRRLEELPSNARRYLDRLQELTGTPIDIISTGADRE
ETIVVRDPFQE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaacatcgtggtaatcggtacccaatggggggatgaagggaagggcaagatc
gtcgatctcctgaccgagcgcgcctccgcggtcgtgcgctttcagggcggtcataacgcc
ggccatacgctggtcatatccggccaaaagacagtcctgcacctcataccctcgggaatc
ctgaggcgcgatgtccgatgctacatagggaacggcgtcgtgcttgcggtagggcccttg
ttcgatgaggtggtggccctggaacgagccggagtcccggtccttgaccgcctgaagatc
agcgatgcctgtccgctcatcctgccgcaccatatcgccctcgacgtcgcccgcgagcgc
gcgcggggcgccgccgccatagggaccacgggccgcggcatcgggccggcctacgaagac
aaggtctcgcggcgcggcctgcggcttggagatatctttgatgagacctcgtttgccgca
aaactgaaggatgtgatggcctatcacaacttcaccctcgagcacttcttccatgccccg
acggtaagctacgaagacacgctggccgagatcatgggttatcgcgaccggctcgcgaag
atctgttgtgatgtcccggaggccctcgacgctcataaggcgcgtggtgaatccctgctc
tttgaaggggcgcagggcaccttcctcgacatcgatcacggcacctatccgttcgtaacc
tcctcgaacaccagcgccggtgccgccgccaccgggtccggcgtcggcccgcatgtgctc
cattacgtgctcggaatcaccaaggcctacgccacgcgcgtcggggccggcccgtttccc
acggaactgttcgacgccgtcggtgatcggctcggtgatcgcggccaggaattcggcgcc
accaccggtcgcaagcgtcgctgtggatggttcgatgccgtagccgtgcgccgcgcgcgc
cagatcaatgggttttcggggctttgcatcaccaagctcgacgtcctggacggcctcgat
acggtgaagatctgcgtcgcctacgaggtcgacggcaagcgtcgtggaacgcctccggcg
gcggccgagaccctggcgcgatgccagccggtgtatgaggagatgccgggatggggcgaa
tcgacggtcggaattcgccgcctcgaggaattaccgtccaatgcccggcgctacctcgat
cggctccaggaactgaccggcacgcccatcgacatcatatcgaccggcgcggatcgcgag
gagaccatcgtggtacgtgatccatttcaggaataa

DBGET integrated database retrieval system