KEGG   Acidiferrobacter sp. SPIII_3: C4901_12400Help
Entry
C4901_12400       CDS       T05469                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acii  Acidiferrobacter sp. SPIII_3
Pathway
acii00630  Glyoxylate and dicarboxylate metabolism
acii01100  Metabolic pathways
acii01110  Biosynthesis of secondary metabolites
acii01120  Microbial metabolism in diverse environments
acii01130  Biosynthesis of antibiotics
acii01200  Carbon metabolism
Module
acii_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C4901_12400
Enzymes [BR:acii01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     C4901_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AWP24025
UniProt: A0A2Z3R373
Position
2484202..2484636
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNRLTQGQFSFLPDLTDAQITAQIQYVLNQGWAIGVEYTDDPHPRNTYWEMFGMP
MFDLKDAAGILMEINDCRKTFPNHYVRVTAFDASQGWETPRMSYIVNRPKKEPGFGLVRQ
EVDGRRMRYTIHSYATDHPESERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaacccgggcaatcgcctgactcaaggacaattctcgtttcttcccgacctg
accgatgcccagatcacagcgcagatccaatacgtgctgaaccagggctgggcgatcggt
gtcgaatataccgacgacccgcacccgcgcaacacctactgggagatgttcggcatgccg
atgttcgacctgaaggacgcggccggcatcctgatggagatcaacgactgccgcaagacc
ttccccaaccactatgtgcgcgtcacggcgttcgacgcgtcccagggatgggagacgccg
cgcatgtcgtatatcgtaaaccgcccgaagaaggaaccgggcttcgggctcgtgcgccag
gaggtcgacggccggcggatgcggtacacgatccacagttacgccaccgaccatccggag
tccgagcgctactga

DBGET integrated database retrieval system