KEGG   Acidiferrobacter sp. SPIII_3: C4901_14605Help
Entry
C4901_14605       CDS       T05469                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
acii  Acidiferrobacter sp. SPIII_3
Pathway
acii00330  Arginine and proline metabolism
acii01100  Metabolic pathways
acii01110  Biosynthesis of secondary metabolites
acii01130  Biosynthesis of antibiotics
acii01230  Biosynthesis of amino acids
Module
acii_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:acii00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    C4901_14605
Enzymes [BR:acii01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     C4901_14605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_binding_2 NAD_Gly3P_dh_N 2-Hacid_dh_C GFO_IDH_MocA ApbA PDH Sacchrp_dh_NADP NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AWP24402
UniProt: A0A2Z3RAE4
Position
2884409..2885230
Genome map
AA seq 273 aa AA seqDB search
MQNFSIGIIGAGHMGLALASGLASRMAPDRIAVSDPHADKRQRVHDLGISAMADNDSVVA
RADLLVLAVKPQAMRDLCAAIAPRVRERRPLVVSVAAGIRGADIARWLEGGPAIIRAMPN
TPALINAGVSVLWANDEATPTQREAAATVLGAVSQVFWLADEALMDAATAISGSGPAYFF
LMVEALAAAGAMLGLPPDLSAALAAGTAAGAGRMVHDHPGEAALLRARVTSPGGTTERAI
KSLLGEGFMEMFGRAAQAACDRSRELGEQLGAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacttctcgataggcatcatcggcgcgggtcacatgggtctggcgctggcctcc
ggcctggcatcgcgcatggcgccggaccgcatagcggtctccgatccacacgccgacaag
cggcaacgcgtccacgacctcgggatcagcgccatggccgacaacgattccgtggtcgcg
cgcgccgacctcctggtattggcggtaaagccgcaggccatgcgtgacctgtgcgccgcc
atcgcccccagggttcgagagcgccggccgctcgtggtctcggtggcggccggcatccgc
ggagcggatatcgcccgctggctagagggcgggccggccatcattcgtgccatgcccaac
accccggccttgatcaacgccggggtcagcgtattgtgggccaatgatgaggccaccccg
acgcaacgcgaagcggcggcgaccgtattgggcgcggtgtcccaggtgttttggctcgca
gacgaggccctcatggatgccgccaccgcgatctccgggagcgggcccgcctacttcttc
ctgatggtcgaggcgctcgccgccgccggagcgatgctgggactcccgccggatctgagc
gcggcgctggccgcgggcacggccgccggcgccgggcgcatggtccacgatcaccccggg
gaggccgcgctcctgcgcgcgcgtgtcacatccccgggcggcaccaccgagcgcgccata
aagagcctcctgggcgagggcttcatggagatgttcggacgcgccgcgcaagcggcctgc
gatcgctcgcgcgagctgggcgagcaactgggggcggcgtga

DBGET integrated database retrieval system