KEGG   Acidipropionibacterium virtanenii: JS278_02615Help
Entry
JS278_02615       CDS       T05538                                 

Gene name
pitA
Definition
(GenBank) Low-affinity inorganic phosphate transporter 1
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
acij  Acidipropionibacterium virtanenii
Brite
KEGG Orthology (KO) [BR:acij00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    JS278_02615 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AXE39753
UniProt: A0A344UWV5
Position
complement(2822044..2823198)
Genome map
AA seq 384 aa AA seqDB search
MTSTLIIVSIVVITALVFDFTNGFHDSANAMATSVATGALSPKVAVTIAAVLNVVGATLS
TEVAKTISSGIVTDSLVTPSMVFAGLVGAILWNLMTWLFGLPSSSSHALFGGLIGAVLVK
AGMNGIHLDVILGKIILPALVAPLVAGLAAALATRVAYRITDHTAHHARGIFKHAQTVSA
SMVALAHGTSDGQKTMGIITLVLVAGGFQASGTPPHWWVILLAGTAIGLGTYSGGWRIMR
TMGKGLCEIESPQGFAAETASTAAILASSHLGFALSTTHVCSGSILGSGIGRRTEVRWST
AGKMGIAWLVTLPCAAVVGALASWIAGWGIPGLLLDLALLLLVAVLILRQSHHHSVDHSN
VNDSGDINIRKQGTNPPVSEGATA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgacatcgactctgatcatcgtctccatcgtcgtgatcacggcactggtgttcgacttc
accaacggcttccatgactcggccaatgcgatggcgacctcggtggccaccggcgcgctg
tccccgaaagtcgcggtgacgatcgcggcggtcctcaacgtggtgggcgcgaccctgtcg
accgaggtcgcgaagaccatctccagcggtatcgtcaccgactccctggtgacgccctcg
atggtcttcgcgggcctggtgggcgccattctgtggaatctcatgacctggctgttcggc
ctgccgtccagctcctcccacgccctcttcggggggctcatcggggccgtcctggtgaaa
gcggggatgaatggaatccacctcgacgtcatcctcggcaagatcatcctcccggccctg
gtggccccgctggtcgccggactcgcggccgcactggcgacgcgcgtcgcgtaccgcatc
accgaccacaccgctcaccatgcccgaggcatcttcaagcacgcccagaccgtctccgca
tcgatggtggccctggctcacggcacctccgacggacagaagaccatgggcatcatcacc
ctggtcctggtggccggcggcttccaggcctccggcacccctccgcactggtgggtgatc
ctgctcgccgggacggccatcggactgggcacctattcgggcggatggcggatcatgcgc
accatgggcaaggggctgtgcgagatcgagtccccccaggggttcgccgccgagaccgcg
tccaccgccgcgatcctcgccagctcccacctcggattcgcactgtcgacgacccatgtc
tgctccggatcgatcctcggctcgggcatcgggcgccgcaccgaggtccgctggtcgaca
gccgggaagatgggcatcgcctggctggtcaccctgccctgcgccgcggtggtcggggcg
ctcgcctcctggatcgccggctgggggatccccggtcttctcctggatctggccctgctg
ctgctagtggccgtgctcatcctgcgccagtcccaccatcacagcgtcgatcacagcaac
gtcaacgactccggtgacatcaacatccgcaaacagggcaccaacccgccggtctccgag
ggagccaccgcatga

DBGET integrated database retrieval system