KEGG   Acidovorax carolinensis NA3: CBP34_05225
Entry
CBP34_05225       CDS       T04997                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
acin  Acidovorax carolinensis NA3
Pathway
acin00626  Naphthalene degradation
acin01100  Metabolic pathways
acin01120  Microbial metabolism in diverse environments
acin01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acin00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CBP34_05225
Enzymes [BR:acin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CBP34_05225
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ART51183
UniProt: A0A240U196
Position
1:1112996..1113994
AA seq 332 aa
MGKSGLLNASDIHGVWSILPTPSKPDASDWRATNTVDLDETARAVEGLIAAGANGILSMG
TLGECESLTWEEKKVFMQTIVETARGRVPVFVGTTTLNTRDTIEQTRYAHSIGADGTMLG
IPMWCNPCVDMAVQYYKDVAEAVPEMNIAIYANTEAFKFDFPRAFWARVSEIRQVVAAKY
IGIEFLLQDLHLTKHRMKLLPLDYQYYAAARMDDFVDAFWSSGTVCGPLVSTTLRDKVIA
ARRTKDWTDAHAFQGRLVKTAAPFPEDSFKTFSIYNVALEKGRIDAAGWMNAGPVRPPYN
DICPASYLDSWKASGQRWAELHKQLETESSGK
NT seq 999 nt   +upstreamnt  +downstreamnt
atgggtaagtcaggactgttgaatgcatcggatattcatggagtatggtcaattcttccg
acaccatccaaaccggatgcgagtgactggcgtgcgactaacaccgttgatctggatgag
actgcccgcgccgttgaaggccttatcgcggctggcgcgaacgggattctgagcatgggt
actttgggtgagtgtgaatcgctaacctgggaggaaaagaaagtcttcatgcaaaccatc
gtggagaccgcgagaggaagggttccagtgttcgttggcaccacaacgcttaatacccgc
gacacgatcgagcagacaaggtacgcccactccattggggccgacggaacaatgttggga
ataccaatgtggtgcaatccctgcgttgatatggctgttcagtactacaaagatgtcgcc
gaagctgttccagagatgaatatcgctatctacgcgaataccgaggctttcaaatttgat
tttccccgcgcgttctgggctcgggtttcagagattcggcaagtcgttgcagcgaaatat
atcggtatcgagttcctgctgcaggatctacatctgaccaagcaccgcatgaagctgctg
ccgctcgactaccaatactatgctgcggcacgtatggatgacttcgttgatgccttctgg
tccagcggtaccgtgtgcgggccattggtttcgacgacgcttcgcgacaaggtcatcgca
gctcggcgaaccaaagactggaccgatgcccacgcatttcagggtcgacttgtgaaaaca
gctgcgccatttcccgaagatagcttcaagaccttttctatttacaacgttgcgctggaa
aaaggccgaatcgatgctgcaggctggatgaacgccggccccgttcgcccaccttataac
gacatctgcccagccagctatcttgactcctggaaagcctcagggcaacggtgggccgaa
ttgcacaagcaacttgaaacggaatcttcggggaaatag

DBGET integrated database retrieval system