KEGG   Acidovorax carolinensis NA3: CBP34_05510Help
Entry
CBP34_05510       CDS       T04997                                 

Definition
(GenBank) polyprenyl synthetase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
acin  Acidovorax carolinensis NA3
Pathway
acin00900  Terpenoid backbone biosynthesis
acin01100  Metabolic pathways
acin01110  Biosynthesis of secondary metabolites
acin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acin00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBP34_05510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:acin01006]
    CBP34_05510
Enzymes [BR:acin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CBP34_05510
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CBP34_05510
Prenyltransferases [BR:acin01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CBP34_05510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ART53517
UniProt: A0A240U7Z5
Position
1:1171791..1172753
Genome map
AA seq 320 aa AA seqDB search
MPAAFDLAGWSRHHLDRVERALGQWVGEGAPAGLGEAMRYAVLDGGKRLRPLLVLAAYEA
VHNGAGPTGSDTALRAGMDEATLRAGMDEAALRAACAVELIHAYSLVHDDMPCMDNDVLR
RGKPTVHVQFGEAQALLAGDALQAFAFELLTPDDARIPPAVQATLCRQLARAAGSAGMAG
GQAIDLASVGLALTQEQLRQMHRLKTGALLQASVMMGAACGGAGATAQKALEGYGAALGL
AFQVVDDILDVVADSATLGKTAGKDAASDKPTYVSLLGLAPAQAHAQELLAQAQAALAAS
GLADTRALAALADMVVNRSY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atcccggccgcttttgatctggccggctggagccgccatcaccttgatcgggtcgagcgg
gcactgggccagtgggtgggcgagggcgcccctgccggcttgggcgaggccatgcgctac
gcagtgctcgacggcggcaagcgcctgcgaccgctgctggtgcttgcggcctatgaggcg
gtgcataacggggctggccctacggggagcgacaccgcgctgcgcgccggaatggacgag
gcgaccctgcgcgccgggatggatgaagcggcgctgcgcgccgcgtgtgccgtcgagttg
atccatgcctattcgctggtacacgacgacatgccctgcatggacaacgatgtgctgcgc
cggggcaagcccacggtgcatgtgcagtttggcgaggcgcaggccctgctggcgggcgat
gccctgcaggcgtttgcttttgaattgctcacgcccgacgacgcgcgcattcccccggct
gtgcaggccacgctgtgccgccagctggcgcgcgcggccggttcggcgggcatggcgggc
ggtcaggcgatcgacctggccagcgtggggctggcgctgacgcaggaacagttgcgccag
atgcaccgcctcaagaccggggcactgctccaggccagcgtgatgatgggcgcggcttgc
ggcggggccggcgccacagcgcaaaaggcgctggagggctacggtgcggcgctcggtctg
gcgtttcaggtggtggacgatattctggatgtggttgccgactcggccacgctgggcaag
acagccggcaaggatgccgcgagcgacaagcccacctatgtctctctgcttgggctggcg
ccggcgcaagcccacgcgcaagagctgctggcgcaggcacaggccgcactggcggcatcg
ggcctggccgacacgcgtgcgctggcggcactggccgacatggtggtgaaccggtcctat
tga

DBGET integrated database retrieval system