KEGG   Acidovorax carolinensis NA3: CBP34_06240Help
Entry
CBP34_06240       CDS       T04997                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
acin  Acidovorax carolinensis NA3
Brite
KEGG Orthology (KO) [BR:acin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acin03016]
    CBP34_06240
Enzymes [BR:acin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CBP34_06240
Transfer RNA biogenesis [BR:acin03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CBP34_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ART51346
UniProt: A0A240U0H6
Position
1:complement(1342779..1343582)
Genome map
AA seq 267 aa AA seqDB search
MPPLHILWRDEHIVAVYKPAGWLVHRTGLDAGETRFVMQTLRDQLGQHVYPVHRLDKGTC
GVLVMALHSAAARALSQAFEHGATHKRYLAMVRGWAPEAIEVDHALKPDDAPADAAVQDA
HTRFRRLAQLTLPEASDARFATTRVSLVEAVPTTGRRHQIRRHLKHLAHPIIGDATHGKG
PLNRWWAERLGHQRLWLHAWHLTVPHPVTGITLQLDSGLQWPAWTTAIAPIDPAANAAPV
DHGAAAPAADWQRLLAGLPWQTAPGAR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgccccccttgcacatcctctggcgcgacgagcacatcgtggccgtttacaagcccgct
ggctggctggtgcaccgcacgggcctggatgcgggcgagacacgctttgtgatgcaaacc
ctgcgcgaccagctcggccagcatgtgtaccccgtgcaccggctcgacaagggcacctgc
ggcgtgctggtgatggcgctgcacagcgccgcggcgcgcgcactgtcgcaggccttcgag
catggggcgacgcacaaacgctatctggccatggtgcgcggctgggcgcctgaagccatc
gaagtggaccacgccctcaagcccgatgacgcccctgccgatgccgccgtgcaggatgcc
cacacgcgctttcgccgcctggcacagctcacactgcccgaggccagtgacgcccgcttt
gccaccacgcgcgtatcgctggtggaggccgtgcccaccaccgggcggcgccaccagatc
cggcgccacctcaagcacctggcgcaccccatcattggcgacgccacgcacggcaaaggg
ccgctgaaccgctggtgggccgagcggctgggccatcaaaggctgtggctacacgcgtgg
catctgaccgtgccgcacccggtaacgggcattaccctgcagctggacagcggcctgcag
tggcccgcatggaccaccgccatcgcccccatcgaccctgccgcaaatgccgcgccagtg
gaccacggcgcggcggcccctgcagcagactggcaacggctgctggcagggctgccctgg
caaaccgcgcccggcgcacggtag

DBGET integrated database retrieval system