KEGG   Acidovorax carolinensis NA3: CBP34_07910Help
Entry
CBP34_07910       CDS       T04997                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
acin  Acidovorax carolinensis NA3
Pathway
acin00564  Glycerophospholipid metabolism
acin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBP34_07910
Enzymes [BR:acin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     CBP34_07910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: ART51606
UniProt: A0A240U185
Position
1:1678584..1679150
Genome map
AA seq 188 aa AA seqDB search
MFFTIPTIMTWTRIVAIPLIVGVFYAPLDPATRNLIATVMFVVFAATDWLDGFLARKLNQ
TSSFGAFLDPVADKFLVCASLLVLVHLQRADVFVALIIIGREIAISALREWMAQIGASKS
VAVHMIGKLKTAVQMTAIPFLLYDGRLFGVIDTGVWGTWLIWVSAVLTVWSMVYYLQKAL
PEIRARVK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcaccattcccaccatcatgacctggacgcgcatcgtcgcgatacctttgatc
gtgggggtgttctacgcgccgcttgacccggccacgcgcaatctcatcgccaccgtgatg
ttcgtggtgtttgccgccaccgactggctcgatggctttctggcgcgcaagctcaaccag
acctcgtcgttcggcgcttttctggacccggtggccgacaagtttctggtgtgcgcatcg
ctcttggtgctggtgcacctgcagcgcgccgatgtgtttgtggcgctcatcatcattggc
cgcgagattgcgatctcggccctgcgcgaatggatggcgcagatcggtgccagcaagagc
gtggccgtgcacatgatcggcaagctcaagaccgcggtgcagatgacggccatcccgttt
ctgctgtatgacgggcgcctgtttggcgtgatcgacaccggggtgtggggcacctggctc
atctgggtatcggctgtgctcacggtctggtccatggtgtattacctgcagaaagccctg
ccagagattcgggcgcgtgtgaagtaa

DBGET integrated database retrieval system