KEGG   Acidovorax carolinensis NA3: CBP34_11985Help
Entry
CBP34_11985       CDS       T04997                                 

Definition
(GenBank) fructose-bisphosphatase class I
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
acin  Acidovorax carolinensis NA3
Pathway
acin00010  Glycolysis / Gluconeogenesis
acin00030  Pentose phosphate pathway
acin00051  Fructose and mannose metabolism
acin00680  Methane metabolism
acin01100  Metabolic pathways
acin01110  Biosynthesis of secondary metabolites
acin01120  Microbial metabolism in diverse environments
acin01130  Biosynthesis of antibiotics
acin01200  Carbon metabolism
Module
acin_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBP34_11985
   00030 Pentose phosphate pathway
    CBP34_11985
   00051 Fructose and mannose metabolism
    CBP34_11985
  09102 Energy metabolism
   00680 Methane metabolism
    CBP34_11985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acin04147]
    CBP34_11985
Enzymes [BR:acin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CBP34_11985
Exosome [BR:acin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBP34_11985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: ART52226
UniProt: A0A240U312
Position
1:2574214..2575221
Genome map
AA seq 335 aa AA seqDB search
MAKNISLTRYLVEQQRVDGLIPGQLRLLLEVVARACKSISHAVNKGALGGVLGSAGSENV
QGEVQKKLDIIANEVLIEANEWGGHLAGMASEEMDGIYVVPNRYPKGEYLLLFDPLDGSS
NIDVNVSIGTIFSVLKMPEDDRGVDEGDFLQPGNQQVAAGYCVYGPQTTLVLTVGDGVAM
FTLDREQGSFVLTQENVRIPEDTKEFAINMSNMRHWDEPVKRYIDECLQGKEGPRGKDFN
MRWIASMVADVHRIMTRGGIFMYPWDKREPHKPGKLRLMYEANPMGWLIEQAGGAATNGK
QRILDIQPTQLHERVSVILGSKNEVDRVTSYHSKL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaacatcagcctgacccgctacctggtcgaacagcaacgcgtggacggtctc
atccccggccaactgcgcctgctgcttgaagtggtcgcgcgggcctgcaagagcatcagc
cacgccgtcaacaaaggcgccctcggtggcgtgctcggcagtgccggcagtgagaacgtg
cagggcgaagtccagaaaaagctcgacatcatcgccaacgaggtgctgatcgaggccaac
gaatggggcggccacctggccggcatggccagcgaggaaatggacggcatctatgtggtg
cccaaccgctaccccaaaggcgaatacctgctgctgttcgatcccctcgatggttccagc
aacattgacgtgaacgtgagcatcggcaccatcttcagcgtgctcaagatgcccgaagac
gaccgcggcgtggatgaaggcgacttcctgcagcctggcaaccagcaggtggcggcaggt
tattgcgtttatggaccacagaccacgctggtgctcacggtgggcgacggcgtggccatg
ttcacgcttgaccgcgaacagggctcgttcgtgctgacgcaagaaaatgtgcgcattccc
gaggacaccaaagaattcgccatcaacatgagcaacatgcgccactgggacgagcccgtg
aagcgctacattgatgagtgcctgcagggcaaggaaggcccgcgcggcaaggacttcaac
atgcgctggatcgccagcatggtggccgacgtgcaccgcatcatgacccgcggcggcatc
ttcatgtacccctgggacaagcgcgaaccccacaagcccggcaagctgcgcctgatgtac
gaggccaaccccatgggctggctcatcgaacaagctggcggcgccgccaccaacggcaag
caacgcatcctggacatccaacccacccagttgcatgaacgcgtcagcgtgatcctgggc
tcaaaaaatgaggtggaccgcgtgacaagctatcattccaagctataa

DBGET integrated database retrieval system