KEGG   Acidovorax sp. 1608163: EAG14_08035Help
Entry
EAG14_08035       CDS       T05680                                 

Definition
(GenBank) cobyrinate a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
acio  Acidovorax sp. 1608163
Pathway
acio00860  Porphyrin and chlorophyll metabolism
acio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acio00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAG14_08035
Enzymes [BR:acio01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     EAG14_08035
    6.3.5.11  cobyrinate a,c-diamide synthase
     EAG14_08035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO MobB DJ-1_PfpI AAA_30
Motif
Other DBs
NCBI-ProteinID: AYM98589
UniProt: A0A3G2G1I3
Position
1782995..1784368
Genome map
AA seq 457 aa AA seqDB search
MAQAAARCPALLIAAPASGQGKTTAVAALARLHTRRGLRVQVFKCGPDFLDPHWHQLASG
QPVHQLDLWMNGEVDCRQRLHAAAQSNDLILIEGVMGLFDGTPSAADLAQRFGVPVMAVV
DASAMAGTFGALAFGLQHYRADMPWAGVLANRVGSERHAQMLRDGLRDSADWMGALMRVS
HGEEPAGAGKKGAALLPERHLGLVAAHELADSAQRLDAAADALAATPLGQMAAQDLQRWA
VDFPAPDDIRPVPPLLAGRTVAVGRDAAFCFTYAANLQTLEQLGARVVFFSPLDDAALPP
CDAVWLPGGYPELHTDRIAANTGMKASLMAHVLQRKPLWAECGGMMALFESITHTDGSTH
PAWGLLPGHVRMQKRLAALGPQQLVVDGRTLRGHTFHYSTAQSDAPVVSRTSRPDEPVAA
DAGEALYRLGSIHASYFHAWFPSSPVAVAHLLGGVTA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagccgctgcccgctgccccgccttgttgattgccgccccggcctcggggcag
ggcaagaccacggcggtggcggcgctggcgcggctgcacacgcgccggggcttgcgcgtg
caggtgttcaagtgcgggccggattttctggacccgcattggcaccagctcgccagcggc
cagccggtgcaccagctggacctgtggatgaacggcgaggtcgattgccgccagcgcctg
catgcagcggcgcaaagcaacgacctcatcctcatcgagggcgtgatgggcctgttcgac
ggcacacccagcgcggccgatctggcccagcgctttggcgtgcccgtgatggccgtggtc
gatgcatcggccatggcgggcacctttggcgcgctggcctttggcctgcaacattaccgc
gcagacatgccctgggccggcgtgctggccaaccgcgtgggcagcgagcggcatgcgcag
atgctgcgcgatggcctgcgtgacagcgccgactggatgggcgcgttgatgcgcgtgagc
catggcgaagagcctgctggcgccggcaaaaaaggcgcggccttgctgcctgagcgccac
ctgggcctggtggctgcgcacgagctggccgacagcgcccagcgcctggacgctgcggcc
gacgcactggccgccaccccgctgggccagatggccgcgcaagacttgcagcgctgggcg
gtggatttccccgcaccggacgacatccggcctgtgccgcccttgctggcgggccgcacc
gtggccgtggggcgcgatgccgcgttttgctttacctacgccgccaacctgcaaacgctg
gagcaactgggcgcgcgcgtggtgtttttctcgccattggatgacgctgcattgccccca
tgcgacgccgtatggctgcccggtggctaccccgagctgcacaccgaccgcatcgccgcc
aacaccggcatgaaggccagcctgatggcccatgtgctgcagcgcaagcccctgtgggcc
gagtgcggcggcatgatggcgctgtttgaatccatcacccacaccgacggaagcacgcac
cccgcttggggcctgctgcccggacatgtccgcatgcaaaagcgcctggccgcgttgggc
ccgcagcaactggtggtggatgggcgcacgctgcgtgggcacaccttccactactccacc
gcgcaaagcgatgcaccggtggtgtcgcgcacctcgcggcccgatgagccggtggcggcc
gatgcgggcgaggcgctgtaccgcctgggcagcatccacgccagctacttccacgcgtgg
ttcccatccagccccgtggccgtggcgcacctgctgggtggagtgactgcgtga

DBGET integrated database retrieval system