KEGG   Acidovorax sp. 1608163: EAG14_08515Help
Entry
EAG14_08515       CDS       T05680                                 

Gene name
ompR
Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
acio  Acidovorax sp. 1608163
Pathway
acio02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acio00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EAG14_08515 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acio02022]
    EAG14_08515 (ompR)
Two-component system [BR:acio02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   EAG14_08515 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ DUF43 PrpR_N
Motif
Other DBs
NCBI-ProteinID: AYM96115
UniProt: A0A3G2FUI9
Position
complement(1885292..1886023)
Genome map
AA seq 243 aa AA seqDB search
MATTTNRTDKVLVVDDDARIRDLLRRYLTQEGFEVMVAEDGKALNRLLLRETVDIIVLDL
MMPGEDGLSICRRLRAANDRTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARI
HAVLRRRPAQEAPGAPSGDNEVVTFGPFTFDLGTRALQRNGEELPLTTGEFAMLKALVRH
PRQPLSREKLALLARGREFEPFDRSLDVQVSRLRKLVEVDAAAPRYIQTVWGVGYVFVPD
GTS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggccactacaaccaatcgcaccgacaaagttctggtggtggatgacgatgcacgcatc
cgcgacctgctgcgccgctacctgacgcaagaaggctttgaagtcatggtggcagaagac
ggcaaggcgctgaaccgcctgctgctgcgcgaaaccgtagacatcatcgtgctggacctg
atgatgcctggcgaagacggcctgtccatctgccgccgcctgcgcgccgccaacgaccgc
acccccatcatcatgctcaccgccaagggcgaggacgtggaccgcatcgtgggcctggaa
gtgggcgccgacgactacctgggcaagcccttcaacccccgcgaactgctggcccgcatc
cacgccgtgctgcgccgccgccccgcgcaagaagcccccggcgccccctcgggcgacaac
gaagtggtcacctttggccccttcacgtttgacctgggcacccgcgccttgcagcgcaac
ggcgaagagttgccgttgaccaccggtgaattcgctatgctcaaggccctggtgcgccac
ccgcgccagccgctgtcgcgcgaaaagctggctttgctggcacgcgggcgcgaatttgag
ccctttgaccgcagcctggacgtccaggtgtcgcgcctgcgcaagctggtggaagtggac
gctgcggcgccccgctacatccagaccgtgtggggtgtgggctatgtttttgtaccggac
ggaacgagctaa

DBGET integrated database retrieval system