KEGG   Acidovorax carolinensis P4: CBP36_00630Help
Entry
CBP36_00630       CDS       T04962                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00071  Fatty acid degradation
acip00072  Synthesis and degradation of ketone bodies
acip00280  Valine, leucine and isoleucine degradation
acip00310  Lysine degradation
acip00362  Benzoate degradation
acip00380  Tryptophan metabolism
acip00620  Pyruvate metabolism
acip00630  Glyoxylate and dicarboxylate metabolism
acip00640  Propanoate metabolism
acip00650  Butanoate metabolism
acip00900  Terpenoid backbone biosynthesis
acip01100  Metabolic pathways
acip01110  Biosynthesis of secondary metabolites
acip01120  Microbial metabolism in diverse environments
acip01130  Biosynthesis of antibiotics
acip01200  Carbon metabolism
acip01212  Fatty acid metabolism
acip02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBP36_00630
   00630 Glyoxylate and dicarboxylate metabolism
    CBP36_00630
   00640 Propanoate metabolism
    CBP36_00630
   00650 Butanoate metabolism
    CBP36_00630
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBP36_00630
   00072 Synthesis and degradation of ketone bodies
    CBP36_00630
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBP36_00630
   00310 Lysine degradation
    CBP36_00630
   00380 Tryptophan metabolism
    CBP36_00630
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBP36_00630
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBP36_00630
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBP36_00630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acip04147]
    CBP36_00630
Enzymes [BR:acip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBP36_00630
Exosome [BR:acip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBP36_00630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SnoaL_4 ACP_syn_III PTA_PTB
Motif
Other DBs
NCBI-ProteinID: ART57564
UniProt: A0A240U7V2
Position
complement(131843..133051)
Genome map
AA seq 402 aa AA seqDB search
MRRAAIVTPVRTPVGTFGGSLRPVPVEELAATTVRAVVQRSGIDPARIDDVVMAQSYANS
EVPCVGRWAALQAGLPVSVPGMQLDRRCGGGLQAIVTAAMMVQSGAADVVIAGGVESMSN
IEYYSTDMRWGARSGNVRFFDRLERGRERSQPVERFGKISGMIETAENLARDYGITREEA
DAYAVRSHQRTAAAWAAGRFNDEIVPVQVPQRKGDPVVFSKDEGFRADVTAESLGKLRVL
MPNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLVGWAAAGCEPSHMGIGPVPA
VKKLLARLNLKIDDMDLVELNEAFACQVLSVLKGWEWQDQDAIAHKLNVNGSGISLGHPI
GATGVRILATLLHELQRRKGRYGLETMCIGGGQGIAAVFERA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagagccgccatcgtcacccctgttcgtacccccgtcggcaccttcggcggcagc
ctgaggcccgtgcccgtggaggagctggcagccaccacggtgcgcgccgtggtgcagcgc
agcggcatcgaccccgcgcgcatcgacgacgtggtcatggcccagtcctacgccaacagc
gaggtgccttgcgtgggccgctgggccgcgctgcaggcgggtttgccggtgtcggtgccg
ggcatgcagctcgataggcgctgcggcggcggcctgcaggccatcgtcacggccgcgatg
atggtgcaaagcggcgccgccgatgtggtgattgccggcggcgtggagagcatgagcaac
atcgagtactacagcaccgacatgcgctggggcgcgcgctcgggcaacgtgcgctttttt
gaccgcctggagcgcggccgcgagcgctcgcagccggtggagcgcttcggcaagatctcg
ggaatgatcgagacggcagagaacctggcgcgcgactacggcatcacgcgcgaggaggcc
gatgcctacgccgtgcgcagccaccagcgcacggcggccgcctgggccgcggggcgcttc
aacgatgaaatcgtccccgtgcaggtaccccagcgcaagggcgacccggttgttttcagc
aaggacgaaggctttcgcgccgatgtgacggccgagagcctgggcaagctgcgcgtgctg
atgcccaacggcaccgtcacggccggcaacgccagccagcaaaacgatgccagcgctgcc
tgcctcatcgtggccgaggacaaactggccgagctgggcctcacgcccatggccacgctg
gtgggctgggcggcggcgggctgcgagccctcgcacatgggcatcggcccggtgccggcc
gtcaaaaagctgctggcgcggctgaacctcaagattgacgacatggacctggtggagctc
aacgaagccttcgcctgccaggtgctgtccgtgctcaagggctgggaatggcaggaccag
gatgccatcgcgcacaagctcaacgtcaacgggtcgggcatctcgctgggccaccccatc
ggcgccaccggcgtgcgcatcctggccacgctgctgcacgaactgcagcgccgcaagggc
cgctacgggctggagacgatgtgcattggcggcggccagggcattgctgcggtattcgaa
cgggcgtaa

DBGET integrated database retrieval system