KEGG   Acidovorax carolinensis P4: CBP36_05840
Entry
CBP36_05840       CDS       T04962                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00626  Naphthalene degradation
acip01100  Metabolic pathways
acip01120  Microbial metabolism in diverse environments
acip01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acip00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CBP36_05840
Enzymes [BR:acip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CBP36_05840
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ART58441
UniProt: A0A240UA97
Position
1239677..1240675
AA seq 332 aa
MAKSGLLNASDIHGVWSILPTPSKPDASDWRATNTVDLDETARAVEGLIAAGANGILSMG
TLGECESLTWEEKKVFMQTIVETARGRVPVFVGTTTLNTRDTIEQTRYAHSIGADGTMLG
IPMWCNPCVDMAVQYYKDVAEAVPEMNIAIYANTEAFKFDFPRAFWARVSEIRQVVAAKY
IGIEFLLQDLHLTKHRMKLLPLDYQYYAAARMDDFVDAFWSSGTVCGPLVSTTLRDKVIA
ARRTKDWTDAHAFQGRLVKTAAPFPEDSFKTFSIYNVALEKGRIDAAGWMNAGPVRPPYN
DICPASYLDSWKASGQRWAELHKQLETESSGK
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctaagtcaggactgttgaatgcatcggatattcatggagtatggtcaattcttccg
acaccatccaaaccggatgcgagtgactggcgtgcgactaacaccgttgatctggatgag
actgcccgcgccgttgaaggccttatcgcggctggcgcgaacgggattctgagcatgggt
actttgggtgagtgtgaatcgctaacctgggaggaaaagaaagtcttcatgcaaaccatc
gtggagaccgcgagaggaagggttccagtgttcgttggcaccacaacgcttaatacccgc
gacacgatcgagcagacaaggtacgcccactccattggggccgacggaacaatgttggga
ataccaatgtggtgcaatccctgcgttgatatggctgttcagtactacaaagatgtcgcc
gaagctgttccagagatgaatatcgctatctacgcgaataccgaggctttcaaatttgat
tttccccgcgcgttctgggctcgggtttcagagattcggcaagtcgttgcagcgaaatat
atcggtatcgagttcctgctgcaggatctacatctgaccaagcaccgcatgaagctgctg
ccgctcgactaccaatactatgctgcggcacgtatggatgacttcgttgatgccttctgg
tccagcggtaccgtgtgcgggccattggtttcgacgacgcttcgcgacaaggtcatcgca
gctcggcgaaccaaagactggaccgatgcccacgcatttcagggtcgacttgtgaaaaca
gctgcgccatttcccgaagatagcttcaagaccttttctatttacaacgttgcgctggaa
aaaggccgaatcgatgctgcaggctggatgaacgccggccccgttcgcccaccttataac
gacatctgcccagccagctatcttgactcctggaaagcctcagggcaacggtgggccgaa
ttgcacaagcaacttgaaacggaatcttcggggaaatag

DBGET integrated database retrieval system