KEGG   Acidovorax carolinensis P4: CBP36_08495Help
Entry
CBP36_08495       CDS       T04962                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
acip  Acidovorax carolinensis P4
Pathway
acip02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acip00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBP36_08495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acip02022]
    CBP36_08495
Two-component system [BR:acip02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CBP36_08495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ DUF43
Motif
Other DBs
NCBI-ProteinID: ART58883
UniProt: A0A240U165
Position
complement(1791972..1792703)
Genome map
AA seq 243 aa AA seqDB search
MATATNRTDKILVVDDDARIRDLLRRYLTQEGFEVMVAEDGKALNRLLLRETVDLIVLDL
MMPGEDGLSICRRLRAANDRTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARV
HAVLRRRPAQEAPGAPSGDNEVVTFGPFTFDLGTRALQRNGEELPLTTGEFAMLKALVRH
PRQPLSREKLALLARGREFEPFDRSLDVQVSRLRKLVEVDAAAPRYIQTVWGVGYVFVPD
GTS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctacagcaaccaaccgtaccgacaagattctggtggtggacgacgatgcacgcatc
cgcgatctgctgcgccgttacctgacccaggaaggctttgaagtcatggtcgccgaagac
ggcaaggccctgaaccgcctgctgctgcgcgaaacggtcgacctcatcgtgctcgacctg
atgatgcccggcgaagacggcctgtctatctgccggcgcctgcgtgccgccaacgaccgc
acgcccatcatcatgctcaccgccaagggtgaggacgtggaccgcatcgttgggctggaa
gtcggcgccgatgactacctgggcaagcccttcaacccccgcgagctgctggcgcgtgtg
cacgccgtgctgcgccgccgccccgcacaggaagcgcccggcgccccgtcgggcgacaac
gaagtggtcaccttcggccccttcaccttcgacctgggcacgcgcgctctgcagcgcaat
ggcgaagagctgccgctgaccaccggcgagttcgccatgctcaaggccctggtccgccac
ccgcgccagccgctgtcacgcgaaaagctggccctgctggcacgcggccgcgagttcgag
ccctttgaccgtagcctggacgttcaggtctcacgcctgcgcaagctggtggaggtagac
gccgccgcgccgcgctacattcagacggtgtggggcgtaggctatgttttcgtaccggac
ggaacgagctga

DBGET integrated database retrieval system