KEGG   Acidovorax carolinensis P4: CBP36_14665Help
Entry
CBP36_14665       CDS       T04962                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00790  Folate biosynthesis
acip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CBP36_14665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acip04147]
    CBP36_14665
Enzymes [BR:acip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CBP36_14665
Exosome [BR:acip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBP36_14665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ART59904
UniProt: A0A240UEH7
Position
3175490..3175825
Genome map
AA seq 111 aa AA seqDB search
MTTMLKKKDWSALTRRALTATETVANLAKIEGWSLAGDGAQVAIEKTFHFANYYETISFV
NAVAFVANAQDHHPDLSVHYNRCVVRLNTHDVQGISATDFDCASRFDALLA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatgttgaagaaaaaagactggtcagcgcttacccgtcgtgcgctgaccgct
acagaaacagtagcaaatctggccaagatcgaaggctggtcgctggctggcgatggtgcc
caggtggccatcgaaaagaccttccatttcgccaattactacgaaaccatttcgttcgtg
aatgccgtggccttcgttgccaatgcacaagaccaccaccccgacctgtcggtgcactac
aaccgctgtgtggtgcgcctgaacacgcacgacgtgcagggcatctccgccaccgacttc
gattgcgcgtcccggttcgacgccctgctggcatga

DBGET integrated database retrieval system