KEGG   Acidovorax carolinensis P4: CBP36_17800Help
Entry
CBP36_17800       CDS       T04962                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00270  Cysteine and methionine metabolism
acip00480  Glutathione metabolism
acip01100  Metabolic pathways
Module
acip_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:acip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CBP36_17800
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP36_17800
Enzymes [BR:acip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     CBP36_17800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST Rimk_N ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ART60425
UniProt: A0A240U752
Position
complement(3828884..3829837)
Genome map
AA seq 317 aa AA seqDB search
MKLLFIADPLESFKIYKDTTFAMMREAQRRGHTLAVCLPQDLVWQRGSQVAARVRDIVLT
GDSTHWFQAQPLRSAALTAFDAVLMRKDPPFDSEYFYATHLLEQAEREGARVFNKPRALR
DHPEKLAIMEFPQFIGPTLVTRDPQDIQRFHAEHQDIILKPLDGMGGMGIFRVGPDGLNL
GSITETLNRHGAQSVMVQKFLPEITEGDKRVLIIGGKPVPFCLARIPQGSEVRGNLAAGG
KGVARPLSARDWEIAEALGPVLQSRGLLLAGVDVIGECVTEINVTSPTCFQEIFDQTGCD
VAYLFVDALEAAVARPA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcctgttcatcgctgatccgctggaaagcttcaagatctacaaagacaccacc
ttcgccatgatgcgcgaggcgcagcggcgcgggcacacgctggcggtctgcctgccgcag
gatctggtctggcagcgcggcagccaggtggctgcacgggtgcgcgacattgtcctcacg
ggtgattcgacccactggtttcaggcgcagcccttgcgcagtgcagcgctcacggcgttc
gatgccgtgctcatgcgcaaggatccaccgtttgacagcgaatatttctatgccacccac
ctgcttgagcaggccgagcgggagggtgcacgcgtcttcaacaagccgcgtgccctgcgc
gatcacccggaaaagctggcgatcatggagtttccgcagttcatcggccccacgctggtg
acgcgcgatccacaagatatccagcgtttccatgcagaacatcaggacatcatcctgaaa
ccgctcgatggcatggggggcatgggcattttccgggtcggcccggatggcctgaatctg
ggcagcatcaccgagacgctcaaccgccatggagcacaaagtgtgatggtgcagaaattc
cttccggagatcaccgaaggcgacaagcgcgtcctcatcattggcggcaagcccgtgccc
ttctgtctggcgcgcattccccaaggcagtgaagtccgcggcaatcttgcggcggggggc
aagggcgtggcgcgcccgctgtctgcacgcgactgggagattgccgaagcgctgggccct
gtcttgcaaagccgcggtttgctactggcgggcgtggacgtcataggagagtgcgtcacc
gagatcaatgtgaccagccccacctgctttcaggagatctttgatcagactggctgcgac
gtcgcctacctgttcgtggacgccctggaggcggcagtggctaggcccgcatga

DBGET integrated database retrieval system