KEGG   Acidovorax carolinensis P3: CBP35_01330Help
Entry
CBP35_01330       CDS       T04998                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
acis  Acidovorax carolinensis P3
Brite
KEGG Orthology (KO) [BR:acis00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CBP35_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ART53996
UniProt: A0A240UH80
Position
complement(297424..297831)
Genome map
AA seq 135 aa AA seqDB search
MPKYQFDVQVAPEYLPEQSSPSSGIFRFAYTITITNAGEAPAQLISRHWIISDARGHTEE
VKGLGVVGQQPLLKPGQSFQYTSGCSLRAASGTMHGTFHCVAVDGEPFSCPIPLFVLEAT
HPGASNQPVSARVLH
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaataccagtttgatgtgcaagtggcgccagagtacctgccggagcagtcctcc
cccagctccggtatctttcgttttgcctacaccatcaccatcaccaatgcgggtgaagca
cccgcgcaactgatctcgcgccactggatcatcagtgatgccaggggccacaccgaagag
gtcaagggcctgggcgtggtgggccagcagcctttgctcaagccgggacaatcgtttcag
tacaccagcggatgcagcctgcgcgccgccagcggaaccatgcatggcacgttccattgc
gtcgctgttgacggtgagccgttcagctgcccgatacccttgtttgtgctggaggcgacc
caccccggcgcttccaaccagccggtgagcgcaagggtgctgcattga

DBGET integrated database retrieval system