KEGG   Acidovorax carolinensis P3: CBP35_18805Help
Entry
CBP35_18805       CDS       T04998                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acis  Acidovorax carolinensis P3
Pathway
acis00071  Fatty acid degradation
acis00072  Synthesis and degradation of ketone bodies
acis00280  Valine, leucine and isoleucine degradation
acis00310  Lysine degradation
acis00362  Benzoate degradation
acis00380  Tryptophan metabolism
acis00620  Pyruvate metabolism
acis00630  Glyoxylate and dicarboxylate metabolism
acis00640  Propanoate metabolism
acis00650  Butanoate metabolism
acis00900  Terpenoid backbone biosynthesis
acis01100  Metabolic pathways
acis01110  Biosynthesis of secondary metabolites
acis01120  Microbial metabolism in diverse environments
acis01130  Biosynthesis of antibiotics
acis01200  Carbon metabolism
acis01212  Fatty acid metabolism
acis02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBP35_18805
   00630 Glyoxylate and dicarboxylate metabolism
    CBP35_18805
   00640 Propanoate metabolism
    CBP35_18805
   00650 Butanoate metabolism
    CBP35_18805
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBP35_18805
   00072 Synthesis and degradation of ketone bodies
    CBP35_18805
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBP35_18805
   00310 Lysine degradation
    CBP35_18805
   00380 Tryptophan metabolism
    CBP35_18805
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBP35_18805
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBP35_18805
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBP35_18805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acis04147]
    CBP35_18805
Enzymes [BR:acis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBP35_18805
Exosome [BR:acis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBP35_18805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ART56551
Position
4044348..4045535
Genome map
AA seq 395 aa AA seqDB search
MTHRDVFVVSTARTAIGTFGGSLKDVPNTQLATTAVKAAIARSGLAPDAVGHVVMGNVIP
TDTKDAYLSRVAAIDAGCPIETPAFNVNRLCGSGLQAIISAAQAIGYGDCDVAVGGGSES
MSRGPYFDTAARYGARMGDTKSIDYMLGILHDPWQKMHMGITAENVAERYKISREMQDQL
ALESQRRAAAAIAAGYFKDQIVPVEIATRKGTVLFQEDEHVRAATTLDVLAGMKPAFRKD
GGTVTAGNASGINDGASAVVLVAGDRISALGVKPLARLVGYAHAGVDPAYMGIGPVPATQ
KVLQRTGLKVQDMDVIEANEAFAAQACAVVQELGLDPAKVNPNGSGISLGHPVGATGAII
TTKAIAELHRTGGRYALVTMCIGGGQGIAAIFERV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccgtgacgtcttcgtcgtcagcaccgcccgcaccgccatcggcaccttcggc
ggcagcctgaaggacgtacccaacacccagctcgccaccaccgccgtcaaagccgccatt
gcccgctcgggcctggcacccgacgccgtgggccatgtggtcatgggcaacgtgattccc
accgacaccaaggacgcctacctctcccgcgtggccgccatcgacgctggctgccccatc
gagacgcccgccttcaacgtcaaccgcctgtgcggctcgggcctgcaggccatcatcagc
gcggcgcaggccatcggctatggcgactgcgacgtggccgtgggcggcggcagcgaatcc
atgagccggggcccctacttcgacaccgccgcacgctacggcgcccgcatgggcgacacc
aagagcatcgactacatgctcggcatcctgcacgacccctggcaaaaaatgcacatgggc
atcaccgccgagaacgtggccgagcgctacaagatctcgcgcgagatgcaggaccagctc
gcgctggagagccagcgccgcgccgccgccgccatcgccgccgggtacttcaaggaccag
atcgtccccgtcgaaatcgccacgcgcaagggcaccgtgctgttccaggaggacgagcat
gtgcgcgccgccaccacgctcgacgtgctggccggcatgaaacccgcgttcaggaaggac
ggcggcacggtcacggccggcaacgcctcgggcatcaacgacggcgccagcgccgtggtg
ctggtggcgggcgaccgcatcagcgccctgggcgtgaagcccctggcccgcctggtgggc
tacgcacacgcgggtgtggacccggcttacatgggcatcggccccgtccccgccacgcag
aaggtgctgcagcgcacgggcctgaaggtgcaggacatggacgtgatcgaggccaacgaa
gccttcgccgcccaggcctgcgccgtggtgcaggagctgggcctggacccggccaaggtc
aacccgaacggctcgggcatttcgctcggccaccccgtgggcgccaccggcgccatcatc
accaccaaggcgatcgccgaactgcaccgcaccggtgggcgctatgcgctggtgaccatg
tgcattggcggcggccagggcattgcggccatttttgaacgagtttga

DBGET integrated database retrieval system