KEGG   Acidovorax sp. KKS102: C380_00430Help
Entry
C380_00430        CDS       T02290                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    C380_00430
Enzymes [BR:ack01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C380_00430
Transporters [BR:ack02000]
 Other Transporters
  Pores ion channels [TC:1]
   C380_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_3 GST_N GST_N_2 GST_C_6 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: AFU43816
UniProt: K0I4F3
Position
complement(92819..93427)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALQEAGLAYTPVLASTKSHKLQDGTDYYTINALGYVPVLELDNG
ERLREGPAIVQYIADQVPDKQLAPANGTLARYRLQEWLTFIGTELHKGFSPLFNPATPEE
YKPMVRERLLQRLQWVDSQLAGKQYLMGDQFTVADGYLFTVTNWTQPTKLDISGLANLAA
YRERVGARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttactactcccccggcgcctgctccctgtccccccacatcgccctgcaagag
gccggcctggcctacacccccgtgctggccagcaccaagagccacaagctgcaggacggc
accgactactacaccatcaatgcgctgggctacgtgcccgtgctggagctggacaacggc
gagcgcctgcgcgaaggcccggccatcgtgcaatacattgccgaccaggtgcccgacaaa
caactcgcccccgccaacggcaccctggcgcgctaccgcctgcaagagtggctgaccttc
atcggcaccgagctgcacaagggcttcagccccctgttcaaccccgccacccccgaggag
tacaagcccatggtgcgcgagcgcctgctgcagcgcctgcagtgggtggacagccagctc
gccggcaagcagtacctgatgggcgaccagttcaccgtggccgacggctacctgttcacc
gtgaccaactggacgcaacccaccaagctcgacatctccggcctggccaacctggcggcc
taccgcgaacgcgtgggtgcccgccccgcagtgcaggcggccatgaaggccgaaggcttg
ctgaaatag

DBGET integrated database retrieval system