KEGG   Acidovorax sp. KKS102: C380_07380Help
Entry
C380_07380        CDS       T02290                                 

Definition
(GenBank) acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00520  Amino sugar and nucleotide sugar metabolism
ack01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C380_07380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ack01005]
    C380_07380
Enzymes [BR:ack01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     C380_07380
Lipopolysaccharide biosynthesis proteins [BR:ack01005]
 Unusual sugar
  C380_07380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: AFU45183
UniProt: K0HQ83
Position
complement(1611236..1611823)
Genome map
AA seq 195 aa AA seqDB search
MTATYTVHPSAIVDDGAQIGEGSRVWHFVHVCAGARIGKDVSLGQNVFVGNKVIIGDHCK
IQNNVSVYDNVTLEDGVFCGPSMVFTNVYNPRSLIERKSEYRNTLAKKGATLGANCTIVC
GSTIGEYAFVGAGAVVNKDVPAYALMVGVPARQIGWMSEFGEQLDLPLQGPAETTCPHTG
ARYVLDGHTLTKLLA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacctacactgtccaccccagcgccatcgtcgacgatggtgcgcagattggc
gaaggatcccgcgtttggcactttgtccatgtttgtgccggtgcacgcataggcaaagac
gtttcactaggccaaaacgtgtttgtaggcaacaaagtcatcattggtgaccactgcaaa
atccagaacaacgttagcgtgtacgacaacgtcacactggaagatggcgtgttctgtggc
cccagcatggtatttaccaacgtctacaacccgcgctcgctaattgaacgcaaaagcgaa
taccgcaataccctggccaaaaagggggccaccctgggcgccaactgcaccatcgtgtgt
ggctccaccattggcgaatacgcctttgtgggcgcgggcgccgttgtcaacaaagacgtg
cctgcctacgcactcatggtaggcgtgcctgcgcgacaaattggctggatgagcgagttt
ggcgagcaactggatctccctctgcaaggccccgctgaaaccacatgcccccataccggt
gcccgttacgtgctggatggccacaccctcaccaaattgctagcgtaa

DBGET integrated database retrieval system