KEGG   Acidovorax sp. KKS102: C380_12780Help
Entry
C380_12780        CDS       T02290                                 

Definition
(GenBank) glutathione S-transferase
Organism
ack  Acidovorax sp. KKS102
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AFU46257
UniProt: K0HZI7
Position
2782353..2782961
Genome map
AA seq 202 aa AA seqDB search
MSIVLYWHPMSSATPIGCALTELGVPHERIKIDIRTGEQRRPEYLALNPNGKVPTLTVDG
APMFEALAIHLWLGHRFGVERGLWPAGGTPEALQALSWCTWSYVTYGALVGRLHVATQGE
AVWRNTAQAEAVLRQLSELLALLDARLAQQPWMLGAHYSLVDLVAGSVVGYSQYLGAPVN
AHPHVQAWLARVQARPAMQIEA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgtcctgtactggcaccccatgtccagcgccacccccatcggctgcgcgctt
accgaactgggtgtgccgcatgagcgcatcaagatcgacatccgcaccggcgaacagcgc
cgccccgaatatctagccctgaaccccaacggcaaggtccccacgctgacggtggacggt
gcgcccatgttcgaggccctggccatccacctgtggttgggccaccgttttggcgtggag
cgcggcctgtggcccgctggcggcacgcccgaggcgttacaggcgctgtcgtggtgcacg
tggtcgtacgtgacctatggcgcgctggtggggcgcctgcatgtggccacccagggcgaa
gcggtgtggcgcaacaccgcccaggcagaggccgttctgcgtcagctgagcgagttgctg
gccctgctggacgcacggctggcccagcaaccctggatgctgggggcccactactcgttg
gtggatctggtggcgggctcagtagtgggctatagccagtacctgggtgcccctgtcaac
gcacatccgcatgtgcaagcgtggctggcccgggtgcaggcgcgcccggcgatgcagatc
gaggcctaa

DBGET integrated database retrieval system