KEGG   Acidovorax sp. KKS102: C380_15935
Entry
C380_15935        CDS       T02290                                 

Gene name
bphA3
Definition
(GenBank) biphenyl dioxygenase ferredoxin subunit BphA3
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00621  Dioxin degradation
ack01100  Metabolic pathways
ack01120  Microbial metabolism in diverse environments
ack01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    C380_15935 (bphA3)
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AFU46882
UniProt: E7FJB4
Position
3470355..3470684
AA seq 109 aa
MTFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDV
VECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSAAALHA
NT seq 330 nt   +upstreamnt  +downstreamnt
atgacgtttaccaaagcctgcagcgtggacgaggttccacccggagaagccttgcaagtc
agccatgacgcgcaaaaggtggcgattttcaatgtcgatggggaattttttgccacacag
gaccagtgcacccacggagagtggtcgctgtccgaaggtggctacctcgacggcgatgtc
gtggaatgctccctgcacatgggaaagttttgtgtgcgcacaggcaaggtcaagtcgccc
ccgccctgcgagcctttgaaggtttacccgattcgcatcgaggggcgggacgtgctggtc
gatttttctgcagccgcgctgcatgcctga

DBGET integrated database retrieval system