KEGG   Acidovorax sp. KKS102: C380_15940
Entry
C380_15940        CDS       T02290                                 

Gene name
bphB
Definition
(GenBank) cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00621  Dioxin degradation
ack01100  Metabolic pathways
ack01120  Microbial metabolism in diverse environments
ack01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    C380_15940 (bphB)
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     C380_15940 (bphB)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase TrkA_N
Other DBs
NCBI-ProteinID: AFU46883
UniProt: E7FJB5
Position
3470703..3471533
AA seq 276 aa
MQLNNEVALVTGGGSGLGRAIVDRFVAEGARVAVLDKSAARLQELQAAHGAKVLGIEGDV
RVLADHQKAARECVAAFGKIDCLIPNAGIWDYSMPLVDIPDDRIDAAFDEVFHINVKGYL
LAVKACLPALVQSRGSVVFTISNAGFYPNGGGPLYTGAKHAVVGMVRELAYELAPHVRVN
GVAPGGMSTDLRGPASLGMANQAISSVPLGEMLTSVLPVGRMPVAAEYTGAYVFFATRGD
TFPTTGALLNHDGGMGVRGFFEAAGGKDLPQKLRLS
NT seq 831 nt   +upstreamnt  +downstreamnt
atgcaactcaacaatgaagtagccctggtcaccggcggtggctcgggcctgggccgggcc
atcgtggaccggttcgtggccgaaggcgcgcgcgtggccgtgctcgacaaatcggccgcc
aggctccaggaactccaggccgcgcacggcgccaaagtgctgggcatcgaaggtgacgtg
cgcgtgctggccgaccaccagaaggccgcgcgcgaatgcgtggccgcctttggcaagatc
gactgcctgatccccaacgcgggcatctgggattattcgatgccgctcgtggacatccct
gacgacaggatcgacgccgccttcgacgaggtcttccacatcaacgtcaagggctatctg
cttgccgtcaaggcctgcctgcccgcgctggtgcaaagccgcggcagcgtggtcttcacg
atctcgaacgcgggcttctacccgaacggcggcggcccgctctatacaggggccaaacat
gccgtggtgggcatggtgcgcgaactcgcctacgaacttgcgccacacgtgcgcgtcaat
ggcgtggcgcccggcggcatgagcactgacctgcgcggcccggcctcgctgggcatggcc
aaccaggccatttcgagcgtgccgctgggtgaaatgctgacctctgtgcttcccgtgggg
cgcatgcctgtggcagcggaatacaccggagcctacgtgttctttgccacgcgcggcgac
accttccccacgacaggcgcgttgctcaaccacgatggtggcatgggcgtgcgcggcttt
ttcgaggctgccgggggcaaagacctgccgcagaaactgcggctttcataa

DBGET integrated database retrieval system