KEGG   Acidovorax sp. KKS102: C380_18345Help
Entry
C380_18345        CDS       T02290                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00860  Porphyrin and chlorophyll metabolism
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C380_18345
Enzymes [BR:ack01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     C380_18345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFU47363
UniProt: K0HWQ4
Position
3987124..3987951
Genome map
AA seq 275 aa AA seqDB search
MGTSAPRVIVTRPAREAAHWVTQLGAHGIQAVALPLIAIGPCTDTAMQQALDTARANVDT
YRALMFVSGNAVVHFFEQKRPVALDIHALTATKTRAWAPGPGTARALEQAGVPRSAIDGP
APDAPQFDSEALWQQVARQVQPGDRVLIVRGRSATPQGAHESPQGNGREWLAQQIAARGG
QVEFVVAYQRGAPRFTAQEVALAQQAAQDGSVWLLSSSEAVAHLPEALPGQQWGAAHALA
THPRIAEAARAAGFGTVRECRPALEDVVASIESAA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctcagcgccccgggtcatcgtcacacgccccgcccgcgaagcggcgcactgg
gtcacgcaactgggcgcacacggcatacaggctgtggcgctgcccctgattgcgattggt
ccctgcacggacaccgccatgcagcaggcgctggacacggcccgcgccaacgtcgacacc
taccgtgccctgatgtttgtgagcggcaatgccgtggtgcacttttttgagcaaaaacgc
cctgtagcgctagatattcatgccctgacagctacaaaaacaagagcatgggcacccggc
ccgggcacagcccgcgcgctggagcaggcgggcgtaccgcgcagcgccatcgacgggcct
gcgcccgacgcaccccagttcgactcggaggcactatggcagcaggtggcccgccaggtg
cagcccggcgaccgcgtgctgatcgtgcgcggccgatccgccacaccccagggcgcacac
gaatcgccccaaggcaacggccgcgagtggctggcccagcagatcgcggcgcggggtggc
caggtggagtttgtggtggcctaccaacgcggcgccccccgcttcacggcgcaagaggtg
gcgctggcgcaacaggcagcccaagatggctccgtctggctgctgagcagctccgaggcg
gtggcccacctgcccgaggccctgccgggccagcaatggggcgccgcccatgcgctggcc
acccacccgcgcatcgccgaagcggcccgcgcagcgggctttggcaccgtgcgggaatgc
cgtccggcgctggaagacgtggtggcctcgatagaatcggccgcatga

DBGET integrated database retrieval system