KEGG   Acidovorax sp. KKS102: C380_21420Help
Entry
C380_21420        CDS       T02290                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00071  Fatty acid degradation
ack00072  Synthesis and degradation of ketone bodies
ack00280  Valine, leucine and isoleucine degradation
ack00310  Lysine degradation
ack00362  Benzoate degradation
ack00380  Tryptophan metabolism
ack00620  Pyruvate metabolism
ack00630  Glyoxylate and dicarboxylate metabolism
ack00640  Propanoate metabolism
ack00650  Butanoate metabolism
ack00900  Terpenoid backbone biosynthesis
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01120  Microbial metabolism in diverse environments
ack01130  Biosynthesis of antibiotics
ack01200  Carbon metabolism
ack01212  Fatty acid metabolism
ack02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C380_21420
   00630 Glyoxylate and dicarboxylate metabolism
    C380_21420
   00640 Propanoate metabolism
    C380_21420
   00650 Butanoate metabolism
    C380_21420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C380_21420
   00072 Synthesis and degradation of ketone bodies
    C380_21420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C380_21420
   00310 Lysine degradation
    C380_21420
   00380 Tryptophan metabolism
    C380_21420
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C380_21420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C380_21420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C380_21420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ack04147]
    C380_21420
Enzymes [BR:ack01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C380_21420
Exosome [BR:ack04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C380_21420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFU47976
UniProt: K0IF15
Position
complement(4659963..4661168)
Genome map
AA seq 401 aa AA seqDB search
MPTTNDIVVVEALRTPRGIAKETGALHRVTPMELLAGLLRELRSRTGVDTNEVADGVFGC
VTQTAEQGGNIGKAACLLADWSPSVPAVTINRYCASGLSAVNLAAQQARNLQGLAVAGGV
EMMSRVPMFSDQAPFYTDQALSRQIGFMPPPWTSDLVATRHNISREDCDAYAALSQSRAA
TARRAGVAKSMVPVRDAQGTLLLDHDENIRESSTQEKLATLRTVYEPGAGGLDDWGLQRE
PELGRINHVHTAGNAPCMADGASAVLLGTQEAAARLGLHARARIVAHADACVALTQTGAV
DATRMALARAGLAVQDIDLWEVRDSFAAITLHYIRTLGIPLDRFNVNGSSIALGHPMGAT
GAMLVSCLLDEMERRGLRYGVAALAGASGVATATVFERIFN
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccactaacgacatcgttgttgtagaagcgttgcgaaccccccggggcatcgcc
aaagagacaggggcgctccatcgggtgactcctatggagttgctggcaggcttgctgcgc
gagctgcgttcgcgcactggcgtggatacgaacgaggtggctgacggcgtcttcggctgc
gtcacccagaccgcagagcagggcggcaatatcggcaaagcggcctgcctgctggccgac
tggagtccgagcgtcccagcggtcacgatcaaccgctattgcgcttccggcttgagtgcc
gtgaatctggccgcacaacaggcccgcaacctgcagggcctggcagtcgcaggtggtgtc
gagatgatgtcgcgggtgcccatgttttccgaccaggccccgttctataccgaccaggcc
ttgagccggcagatcggcttcatgcccccgccctggacatccgacctggtggcgacccgc
cacaacatcagccgtgaggactgcgacgcctatgcggcgctgtcgcagtcgcgtgctgca
acggcgcggcgtgcgggcgtggccaagtcgatggtgccggtgcgggatgcgcaaggcacg
ctgctgctggaccacgatgaaaacatccgtgaatcgagcacgcaggagaagctggccacc
ttgcgcacggtctacgagcccggcgctggcgggcttgatgactggggtttgcagcgtgag
cctgaactcgggcgcatcaaccatgtgcacacggccggcaatgccccttgcatggccgac
ggggcaagcgcggttttgctgggaacccaggaggctgcagcgcggctgggactgcacgcc
cgcgcccgcatcgtggcgcacgcagacgcctgcgtagccctgacgcaaaccggggcggtc
gatgcgacccgcatggcgttggcgcgtgccggcctcgccgtgcaggacatcgatctgtgg
gaggtgcgggactcgtttgccgcaatcaccttgcactacatccggaccctgggtatcccc
ttggaccgcttcaacgtcaacggcagctcgattgcgctgggtcatcccatgggcgccacg
ggggcgatgctggtgagctgcctgctggacgaaatggagcgccgcggtctgcgctatggc
gtggcagcactggccggcgcctccggggtcgccactgccacagtgtttgaacgcattttc
aattaa

DBGET integrated database retrieval system