KEGG   Acholeplasma laidlawii: ACL_0028
Entry
ACL_0028          CDS       T00659                                 

Symbol
pfl
Name
(GenBank) pyruvate formate lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
acl  Acholeplasma laidlawii
Pathway
acl00620  Pyruvate metabolism
acl00640  Propanoate metabolism
acl00650  Butanoate metabolism
acl01100  Metabolic pathways
acl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACL_0028 (pfl)
   00640 Propanoate metabolism
    ACL_0028 (pfl)
   00650 Butanoate metabolism
    ACL_0028 (pfl)
Enzymes [BR:acl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     ACL_0028 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABX80671
UniProt: A9NE91
Position
32364..34634
AA seq 756 aa
MAQSWKGFKSGNWEKAVDVADFIKQNYSEYTGDGTFLEGAVESSLSLNESFKDLLKLEKE
KGGVIDLDTKVASTIISHAPGYIDKDIEKIVGLQTDAPLKRGFFPEGGINVAVKSVEAYG
YKVEQETIDIYTNVRKTHNQGVFDAYTKEIRNARSSHIITGLPDGYGRGRIIGDYRRVPL
YGVDALIKDKYAQQEELTFPMSEHKIRLREELSDQIKSLNELIQLGDMYGFDLRRPASDS
KEAIQWLYLAYLAAVKEQNGAAMSLGRVDAFLDIYIERDLKAAKYSELEIQEFIDHFVMK
LRMVRFARTPEYNQLFTGDPTWVTAVLGGMSNDGRSLVTKTAFRLLQTLYNLGTSAEPNL
TVLWSNNLPEGFKNFTAKVSIDTSSIQYENDDTIRPLHGDDYGIACCVSPMAIGKEMQFF
GARANIAKALLYALNGGRDEVSGKQVFEKSKMEVLKTDVLDYDVVMSRYEKTLEELAEVY
VNALNIIHYMHDKYAYEKLEMALHDRDVKRLFATGIAGLSVVADSLSAIKYAKVHPIYDE
TSGLITDFETVGEFPCYGNDDDRVDDIAVDVLRKFMSYIRKNPTYRESHPTMSVLTITSN
VVYGKNTGNTPDGRRYGEPFAPGANPMHGRDKSGALKSLMSVAKLPYEDAEDGISNTFTI
IPKALGHSISAEGSIVHLVDDVQVNNLVSLLDGYFTSGGYHLNVNVFNRETLKAAYDNPE
LYPNLTIRVSGYAVNFSNLTNEQKLEVMKRTFHEGF
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggctcaatcatggaaaggttttaaatctggtaactgggaaaaagcagtcgatgttgca
gatttcataaaacaaaactattcagagtatacaggagacggcacttttttagaaggtgca
gtagaaagttctttatcattaaatgaatcttttaaagatttattgaaacttgaaaaagaa
aaaggtggcgtaattgatttagatacaaaggttgcatctacaatcattagccatgcgcca
gggtatatcgataaagatatcgaaaaaattgttggtttacaaactgatgcaccattaaaa
cgtggattctttcctgaaggtggaattaacgttgctgtaaaatccgttgaagcttatggt
tataaagtagaacaagaaacaattgatatttatacaaacgttagaaaaacacataaccaa
ggtgtatttgatgcatatactaaagaaattagaaacgctagaagttctcatatcattact
ggtttaccagacggatatggtagaggacgtattattggagattatagaagagtacctctt
tatggtgtagacgctttaatcaaagataaatatgcacaacaagaagaattaacattccca
atgtctgagcacaaaatccgtttaagagaagaattatctgatcaaattaaatcattaaat
gaattaattcaattaggagatatgtacggatttgacttaagaagacctgcaagtgactca
aaagaagcgattcaatggttatacttagcttatttagcagctgttaaagaacaaaacggt
gcggcaatgagtttaggtagagtcgatgcattcttagatatctatatcgaaagagactta
aaagctgcaaaatatagcgaattagaaattcaagaatttattgaccatttcgtcatgaaa
ttaagaatggtacgttttgctagaactccagaatataaccaattatttacaggagatcca
acatgggttactgctgtattaggtggtatgtcaaatgatggtagatcacttgttacaaaa
acagcattcagattattacaaactttatataacctaggtacatcagcagaaccaaacctg
actgttttatggagcaacaaccttccagaaggatttaaaaacttcactgcgaaggtaagt
attgatacttcaagtattcaatatgaaaatgatgatacaattagaccactacatggcgat
gactatggtatcgcatgttgcgtgtcaccaatggctattggtaaagaaatgcaattcttt
ggtgcacgtgcaaacatcgctaaagcattattatatgcattaaatggtggacgtgacgaa
gtaagtggcaaacaagtatttgaaaaatctaagatggaagttttaaaaactgatgtatta
gattatgatgttgtgatgtcacgttatgaaaaaacattagaagaattagctgaagtttat
gtgaatgctttaaacattattcactacatgcatgataaatatgcatatgaaaaactagaa
atggctttacatgatcgtgatgttaagagattatttgcaactggtattgcaggattaagc
gttgttgctgactcattatcagcaatcaaatatgcaaaagtacacccaatctatgatgaa
acatcaggattaattactgactttgaaactgttggtgaattcccatgttatggtaatgat
gatgatagagttgatgatattgctgtagatgtattacgtaaattcatgagctatattaga
aagaacccaacatacagagaatcacatccaacaatgagtgttttaacgattacatctaac
gttgtatacggtaaaaacacaggtaatacaccagatggtcgtcgttatggtgaaccattt
gctccaggtgctaacccaatgcacggtagagataaatcaggtgcattaaaatcattaatg
tctgttgctaaattaccatatgaagatgcagaagacggtatttcaaatacatttacaatt
attccaaaagcattaggtcattcgataagtgctgaaggttctattgttcaccttgtagat
gatgtacaagtaaataaccttgtatccttattagatggatacttcacatctggtggatat
catttaaacgttaacgtgtttaacagagaaacattaaaagcagcttatgacaacccagaa
ttatatccaaaccttacaattagagtatcaggttatgctgtaaacttctcaaatctaacg
aatgaacaaaaattagaagttatgaagcgtacattccatgaaggattctaa

DBGET integrated database retrieval system