KEGG   Acholeplasma laidlawii: ACL_0406
Entry
ACL_0406          CDS       T00659                                 

Gene name
smpB
Definition
(GenBank) SsrA-binding protein
  KO
K03664  SsrA-binding protein
Organism
acl  Acholeplasma laidlawii
Brite
KEGG Orthology (KO) [BR:acl00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ACL_0406 (smpB)
SSDB
Motif
Pfam: SmpB
Other DBs
NCBI-ProteinID: ABX81027
UniProt: A9NF97
Position
427129..427578
AA seq 149 aa
MKIITQNKKAHFEYFIEQKFVAGIKLQGSEVKSIRAGKCSINEAYITFRNGEVFILNMHI
AKFDASSIFNHEETRTRKLLLNRSEIDKLMGAQTRDGMTIIPLTVELHEGLIKVVIALAK
GKKLFDKRETIKERDIKREQQQSLKGKMR
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaaattattactcaaaataaaaaagcacattttgaatattttattgaacaaaaattc
gtggctggtattaaacttcaaggtagtgaagttaaaagtattagagcgggcaaatgttca
attaatgaagcctatatcacatttagaaatggagaagtttttatcttaaacatgcacatt
gcaaaatttgatgcatcctctatttttaatcatgaagaaacgagaactagaaaactatta
ttaaacagaagcgaaattgataaacttatgggcgcacagactagagatggtatgaccatt
attcctttaactgtagaacttcatgaaggtttaattaaagtagttattgcacttgctaag
ggtaaaaagttgtttgataaacgtgaaacgattaaagaacgtgatatcaaacgtgaacag
caacaatcacttaaagggaaaatgagatga

DBGET integrated database retrieval system