KEGG   Acholeplasma laidlawii: ACL_0503Help
Entry
ACL_0503          CDS       T00659                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase, thiolase II
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acl  Acholeplasma laidlawii
Pathway
acl00071  Fatty acid degradation
acl00072  Synthesis and degradation of ketone bodies
acl00280  Valine, leucine and isoleucine degradation
acl00310  Lysine degradation
acl00362  Benzoate degradation
acl00380  Tryptophan metabolism
acl00620  Pyruvate metabolism
acl00630  Glyoxylate and dicarboxylate metabolism
acl00640  Propanoate metabolism
acl00650  Butanoate metabolism
acl00900  Terpenoid backbone biosynthesis
acl01100  Metabolic pathways
acl01110  Biosynthesis of secondary metabolites
acl01120  Microbial metabolism in diverse environments
acl01130  Biosynthesis of antibiotics
acl01200  Carbon metabolism
acl01212  Fatty acid metabolism
acl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACL_0503 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    ACL_0503 (atoB)
   00640 Propanoate metabolism
    ACL_0503 (atoB)
   00650 Butanoate metabolism
    ACL_0503 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACL_0503 (atoB)
   00072 Synthesis and degradation of ketone bodies
    ACL_0503 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACL_0503 (atoB)
   00310 Lysine degradation
    ACL_0503 (atoB)
   00380 Tryptophan metabolism
    ACL_0503 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACL_0503 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACL_0503 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACL_0503 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acl04147]
    ACL_0503 (atoB)
Enzymes [BR:acl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACL_0503 (atoB)
Exosome [BR:acl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACL_0503 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABX81121
UniProt: A9NFJ1
Position
526905..528116
Genome map
AA seq 403 aa AA seqDB search
MNKVFVVAAKRSAIGSYLGTLSQISPADFGSQVLKQTLELNDIKPEWVDEVIIGNVLPAG
QKQGLPRQISIKAGISPEVPAYGVNMICGSGMKSVITGVANIKAGFANLVVAGGVESMSQ
APYLVPGTVRNGVKMGNLELVDYMVTDGLSDAFEGYHMGITAENIVEKHKFTREMQDDFA
YHSQVKAKQAQEKGLFDKEIVPVKIQSRKAEIVFDKDEYINYTTTREKIAQLRPAFKKDG
TVTAASSSGINDGASFMVLASEAFVKEHNLKPLAEIVGVGQAGVEPSVMGLGPVPAIKNS
LKQANLKISDIDTFELNEAFAAQALGVVRELSEDLGIKESAILDKTNPNGGAIALGHPVG
ASGNRIMVTLLHNMLRNENHNIGLASLCIGGGMGTSVIFKKVK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtttttgttgtagctgctaagagaagtgccattggatcttacttaggtaca
ttgtcacaaatcagtccagcagattttggttctcaagttttaaaacaaacattggaactt
aatgacatcaaaccagagtgggttgatgaagttattattggtaatgtactaccagcaggt
caaaaacaagggttaccaagacaaatctctatcaaagcaggtatttctccagaagtacca
gcgtatggtgtaaatatgatttgtggttctggtatgaaatcagttatcacaggtgttgca
aacattaaagctggttttgcaaacttagttgttgcaggtggtgtggaatctatgtcacaa
gctccatatttagtaccaggcactgttagaaacggtgtaaaaatgggtaatttagaattg
gttgactacatggttacagatggtctttcagatgcgtttgaaggctatcacatgggtatt
actgctgaaaacatcgtagaaaaacataaatttactcgtgaaatgcaagatgattttgca
tatcactcacaagttaaagcaaaacaagctcaagaaaaaggcttatttgataaagaaatc
gttccagtaaaaattcaatctagaaaagctgaaattgtgtttgataaagatgaatatatc
aattacacgactactagagaaaaaattgctcaattacgtccagcattcaaaaaagatgga
acagtcactgcagcaagttcatcaggtattaatgatggtgcaagttttatggtcttagca
agtgaagcatttgtaaaagaacataatttaaaaccattagctgaaattgttggtgttggt
caagctggtgttgaaccaagcgttatgggtttaggacctgtacctgcaattaaaaattca
ttaaaacaagcgaaccttaagattagtgatattgatacatttgaattaaacgaagcattt
gcagcacaagcattaggtgttgtacgtgaactttctgaagatttaggtattaaagaatca
gcaatcttagataaaacaaatccaaatggtggtgcgatcgcgttaggtcacccagttgga
gcatcaggtaatagaatcatggttacactattacataatatgttaagaaatgaaaaccat
aatattggtttagcaagtctatgtatcggtggcggtatgggaacatctgtcatctttaaa
aaagttaaataa

DBGET integrated database retrieval system