KEGG   Acholeplasma laidlawii: ACL_1176Help
Entry
ACL_1176          CDS       T00659                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (NADP) (phosphorylating
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
acl  Acholeplasma laidlawii
Pathway
acl00010  Glycolysis / Gluconeogenesis
acl01100  Metabolic pathways
acl01110  Biosynthesis of secondary metabolites
acl01120  Microbial metabolism in diverse environments
acl01130  Biosynthesis of antibiotics
acl01200  Carbon metabolism
acl01230  Biosynthesis of amino acids
Module
acl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACL_1176 (gap)
Enzymes [BR:acl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     ACL_1176 (gap)
Membrane trafficking [BR:acl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ACL_1176 (gap)
Exosome [BR:acl04147]
 Exosomal proteins
  Proteins found in most exosomes
   ACL_1176 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N Semialdhyde_dhC DapB_N
Motif
Other DBs
NCBI-ProteinID: ABX81775
UniProt: A9NHE5
Position
complement(1229068..1230081)
Genome map
AA seq 337 aa AA seqDB search
MAIKVAINGFGRIGRLAFRLMVDNPAFDVVAINDLTDTETLAYLLKYDTAQGPFKGHEVS
TNGDKLVVDGKSITVYAQKDPSELPWGTLGVDVVLESTGLFTSAEKAGLHIKAGAKKVVV
SAPATGEGVKTVVYNVNDDILDGTETIVSAASCTTNALAPLAKVLDDNFGIVKGFMTTVH
AYTNDQSLMDQPHKKGFMSRRGRAAAASIIPSSTGAAAAIGLVLPQLKGKLDGTALRVPT
ITGSIVDLTVELGKEVTLAEIDAAFKAAANESLQYQPDPIVSADVIGSHFGSVYDANTTQ
ILKTDAKFVKVMGWYDNEMSYTAQLIRVMAKIANLTK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaagtagcaattaacggatttggtcgtattggtagacttgcgtttcgttta
atggtagataacccagcatttgatgttgtggcaatcaacgatttaactgatacagaaact
cttgcttaccttttaaagtatgatacagctcaaggtcctttcaaaggtcatgaagtatca
acaaacggagataaattagtagttgatggtaaatcaatcactgtttacgctcaaaaagat
ccatctgagttaccatggggtacacttggtgttgacgtagtattagagtcaacaggatta
ttcacatcagctgaaaaagctggtttacacatcaaagcgggtgctaagaaagttgtagtt
tctgcaccagcaacaggtgaaggcgttaaaactgttgtttacaacgtaaacgatgacatc
ttagatggaactgaaacaatcgtttcagctgcatcatgtacaactaatgctttagctcct
ttagcaaaagttttagatgacaactttggtatcgttaaaggtttcatgactactgttcat
gcttacactaatgaccaatcattaatggatcaaccacacaaaaaaggtttcatgtcaaga
cgtggacgtgctgctgctgctagcattattccatcttcaacaggagctgctgctgcaatc
ggtttagtattacctcaattaaaaggtaaattagacggaacagctttacgtgtacctaca
attactggttcaatcgttgacttaacagttgaattaggtaaagaagtaacattagctgaa
attgatgctgctttcaaagctgctgctaacgaatcattacaatatcaaccagatccaatc
gtttctgctgacgtaattggttctcattttggatcagtttatgatgcaaacacaactcaa
atcttaaagacagatgctaaatttgttaaagttatgggttggtatgacaatgaaatgtca
tatactgctcaactaatcagagtaatggcaaaaatcgctaatttaactaagtaa

DBGET integrated database retrieval system