KEGG   Acholeplasma laidlawii: ACL_1206Help
Entry
ACL_1206          CDS       T00659                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acl  Acholeplasma laidlawii
Pathway
acl00010  Glycolysis / Gluconeogenesis
acl00051  Fructose and mannose metabolism
acl01100  Metabolic pathways
acl01110  Biosynthesis of secondary metabolites
acl01120  Microbial metabolism in diverse environments
acl01130  Biosynthesis of antibiotics
acl01200  Carbon metabolism
acl01230  Biosynthesis of amino acids
Module
acl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACL_1206 (tpiA)
   00051 Fructose and mannose metabolism
    ACL_1206 (tpiA)
   00562 Inositol phosphate metabolism
    ACL_1206 (tpiA)
Enzymes [BR:acl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACL_1206 (tpiA)
Exosome [BR:acl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACL_1206 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACL_1206 (tpiA)
  Exosomal proteins of melanoma cells
   ACL_1206 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: ABX81805
UniProt: A9NHH5
Position
complement(1256041..1256805)
Genome map
AA seq 254 aa AA seqDB search
MAKRIPVIAANWKMFKTKDEALEFIFAVNAAVPSRDEVESIICAPAILLNLLVKREGEHI
RIGAQNMHYADEGAFTGENSPAQVKTAGAEYILIGHSERRSLFNETDKDVNLKMHAAFKY
DLAPILCIGEQLDTREANKTKEVLDVQLDKAFEGVSKEQALKTIVAYEPVWAIGTGKTAT
PQMANDTIKDVRAKLSDLYGAEVAAQVRILYGGSVKPDNIESLLQESDIDGALIGGAALD
HKNFLTFTKAAKNK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagaatacctgtaattgcagcaaactggaaaatgtttaaaactaaagatgag
gctttagaattcatttttgctgtaaatgctgcagtaccaagtagagacgaagttgagtct
attatttgtgcaccagcaatcttattaaacttattagtaaaacgtgaaggcgaacatatc
cgtattggtgcacaaaatatgcactatgctgatgaaggcgcatttactggagaaaactca
cctgcacaagtaaaaactgctggtgctgaatatatcttaattggacactcagaacgtcgt
agtttatttaatgaaacagacaaagacgtaaatttaaaaatgcatgctgcatttaaatat
gacttagctccaattttatgtatcggtgaacaattagatacaagagaagcaaataagact
aaagaagtattagatgttcaattagacaaagcattcgaaggtgtttctaaagaacaagca
ttaaaaacaattgtggcttatgaaccagtgtgggcaatcggaacaggtaaaactgctaca
ccacaaatggcaaacgatacaatcaaagatgtacgtgctaaactaagtgacctatatggt
gctgaagttgcagctcaagtacgtatcttatatggtggttctgttaaaccagataacatc
gaaagtctattacaagaatcagacatcgatggtgctttaatcggtggcgcagcattagat
cataaaaacttcttaacatttacaaaagcagcaaaaaacaaataa

DBGET integrated database retrieval system