KEGG   Acholeplasma laidlawii: ACL_1310Help
Entry
ACL_1310          CDS       T00659                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acl  Acholeplasma laidlawii
Pathway
acl00010  Glycolysis / Gluconeogenesis
acl00020  Citrate cycle (TCA cycle)
acl00620  Pyruvate metabolism
acl01100  Metabolic pathways
acl01110  Biosynthesis of secondary metabolites
acl01120  Microbial metabolism in diverse environments
acl01130  Biosynthesis of antibiotics
acl01200  Carbon metabolism
Module
acl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACL_1310 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ACL_1310 (pdhC)
   00620 Pyruvate metabolism
    ACL_1310 (pdhC)
Enzymes [BR:acl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ACL_1310 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C PTS_EIIA_1 HlyD_D23 HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABX81905
UniProt: A9NHS5
Position
complement(1368069..1369703)
Genome map
AA seq 544 aa AA seqDB search
MYEFKFADIGEGIHEGTVLQWNFKVGDKVKEGETLVIVETDKVNAELPSPVDGTIVSLGA
KEGEEIHVGQIIVTIDDGTGTPAAAPAPAQVSAPTPAPAAAPQVAAPAASGDIYDFKFAD
IGEGIHEGTILQWNFKVGDKVKEGETLVVVETDKVNAELPSPVDGTILKLGKAEGEVIHV
GETVVLIGQNGATLEQAQAPKAEAPVSEPKKGAGVVGEIEVSDDIIGGSEEVHVVATTGK
VLASPVARKLASDLGVDIATIKGSGEQGRVMKDDVQNSKAPAKAQAPVQQTQAPAQAAAS
VAPSFAAAGKPQGDVEVVKITRLRKAVSNAMTRSKSIIPETVLMDEINVDALVNFRNEAK
GLAESKGIKLTYMAFIAKAVLIALKEFPMFNASFNHDTDEVYIKKFINLGMAVDTPDGLI
VPNIKNADRLSVFELASQVRSLADDTIARKISMDQQTGGTFTITNFGSAGIAFGTPVINY
PELAILGIGKIDRKPWVVGNEIKIAHTLPLSLAVDHRIIDGADGGRFLMRVKELLTNPTL
LLLS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatttaaatttgccgacatcggcgaaggtatccatgaaggtaccgtcttacaa
tggaattttaaagttggagataaagtaaaagaaggcgaaacattagttattgttgaaaca
gacaaagtaaacgctgaattaccatctccagttgatggaacaattgtttcattaggtgct
aaagaaggtgaagaaattcacgttggtcaaatcatcgttacaatcgatgacggcacaggt
acacctgctgctgctccagctcctgctcaagtatcagctccaactccagcaccagctgca
gcacctcaagtagctgcaccagctgcaagtggcgatatctatgatttcaaatttgctgac
attggagaaggtatccatgaaggaacaattctacaatggaacttcaaagttggcgacaaa
gtaaaagaaggcgaaacattagttgttgttgaaacagataaagtgaacgctgaattacca
tctccagtagatggaactatcctaaaattaggtaaagctgaaggtgaagtgattcacgta
ggcgaaactgttgtattaattggacaaaatggtgctacattagaacaagctcaagctcca
aaagctgaagctccagtatctgaacctaaaaaaggtgcaggtgttgttggtgaaatcgaa
gtatctgatgatatcatcggtggttcagaagaagttcatgttgttgcaactactggtaaa
gtattagcgtctccagttgctcgtaaattagcaagtgatttaggtgttgatattgcaact
attaaaggtagtggcgaacaaggtagagttatgaaagatgatgttcaaaactctaaagct
ccagctaaggctcaagcaccagttcaacaaacacaggctccagcacaagcagctgcttca
gttgctccaagttttgctgctgcaggtaaaccacaaggtgatgttgaagttgttaagatc
acacgtttacgtaaagcagtatctaatgcaatgacacgttctaaatctattattcctgaa
acagtattaatggatgaaatcaacgtagatgcattagtaaactttagaaatgaagctaaa
ggtttagctgaatctaaaggtattaaattaacttacatggcatttattgctaaagcagta
ttaattgcattaaaagaattcccaatgttcaatgcatcatttaaccatgatacagatgaa
gtgtatatcaaaaaattcattaacctaggtatggctgttgatacaccagatggtttaatt
gttccaaatatcaagaatgcagacagactaagtgtatttgaacttgcttcacaagtgcgt
tcacttgctgatgatacaattgcaagaaagatttctatggatcaacaaactggtggtaca
tttacaatcactaactttggttcagcaggtattgcatttggaacacctgtaattaactac
ccagaattggcaatcttaggtattggtaagattgatagaaaaccttgggttgtaggtaat
gaaattaaaattgctcatacattaccattatcattagctgttgaccacagaatcattgat
ggtgcagatggtggtagattcttaatgagagtaaaagagttattaactaaccctacatta
ttgttattaagctaa

DBGET integrated database retrieval system