KEGG   Granulicella tundricola: AciX9_0350Help
Entry
AciX9_0350        CDS       T01411                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acm  Granulicella tundricola
Pathway
acm00040  Pentose and glucuronate interconversions
acm00052  Galactose metabolism
acm00500  Starch and sucrose metabolism
acm00520  Amino sugar and nucleotide sugar metabolism
acm01100  Metabolic pathways
acm01130  Biosynthesis of antibiotics
Module
acm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AciX9_0350
   00052 Galactose metabolism
    AciX9_0350
   00500 Starch and sucrose metabolism
    AciX9_0350
   00520 Amino sugar and nucleotide sugar metabolism
    AciX9_0350
Enzymes [BR:acm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AciX9_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADW67422
UniProt: E8WWU4
Position
complement(422794..423672)
Genome map
AA seq 292 aa AA seqDB search
MTPKKIRKAVFPAAGLGTRFLPATKATPKEMLCLVDKPLIQYGVEEAVAAGCTEIIIITS
RGKTTMEDHFDSNPELEASLAAKNKTALLEIARSVSKLAKITFTRQSQPLGLGHAVLMAK
EIVGDEPFAVLLPDDIVDADTPCMKQMVEAFNETQCSILGSEVVEGDAISAYGCLDCSVE
PSNPRLLAVKGMVEKPKPGTQPSQNAIIGRYILTPRIFEMIEHITPGAGGELQLTDAIKA
LLQHEKVYGFSYEGKRHDAGDKQGFLRATVELALKHPQLGPDFRTWLKNFPA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacaccaaagaagatccgtaaagcagtcttccccgcagcgggattggggactcgtttt
ctccccgccaccaaggccactcccaaagagatgctctgcctcgtcgacaagcccctcatc
cagtacggagttgaggaggccgtcgccgccggctgcactgagatcatcatcatcacctcc
cgcggcaagaccaccatggaggatcacttcgactccaatccggagctcgaagcctcgctg
gccgccaagaacaagaccgcgctgctcgagatcgcacgctccgtctccaagctcgccaag
atcaccttcacccgccagtcgcagcccctcggtctcggccacgccgtcctcatggccaaa
gagatcgtcggcgacgagccctttgctgtcctcctcccggacgatatcgtcgacgccgat
acgccctgcatgaagcagatggtggaggccttcaacgagacccaatgcagcattctgggc
tcagaggtcgtcgaaggcgacgcgatctccgcctatggctgcctcgactgctccgtcgaa
ccttccaatccacgcctcctggccgtcaagggcatggtcgaaaagcctaaacccggcacc
cagcccagccagaacgccatcatcggccgttacatcctgaccccgcgcatcttcgagatg
atcgagcacatcactcccggcgcaggcggagagcttcagctcaccgacgccatcaaggcc
ctgctccagcacgaaaaggtctacggcttcagctacgaaggcaagcgccacgacgccgga
gacaagcagggctttctccgcgcaacagtagaactagccctcaaacacccccagcttggc
cctgacttccgcacctggctcaagaacttccccgcctaa

DBGET integrated database retrieval system