KEGG   Granulicella tundricola: AciX9_1740Help
Entry
AciX9_1740        CDS       T01411                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
acm  Granulicella tundricola
Pathway
acm00052  Galactose metabolism
acm00561  Glycerolipid metabolism
acm00600  Sphingolipid metabolism
acm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AciX9_1740
  Lipid metabolism
   00561 Glycerolipid metabolism
    AciX9_1740
   00600 Sphingolipid metabolism
    AciX9_1740
Enzymes [BR:acm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AciX9_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Glyco_hydro_97 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-ProteinID: ADW68788
UniProt: E8WYV2
Position
complement(2027975..2029183)
Genome map
AA seq 402 aa AA seqDB search
MRPFLRTITSLLLFAPLLPMHAQQTAKLAATPPMGWNSWNWFAGKVTDKDVRQAADLLVS
SGMRDAGYVYVNIDDTWEGKRDSTGVLHTNEKFPDMKALADYVHSKGLKLGIYSSPGSQT
CARFEGSFGHEQQDADLYASWGIDYLKYDLCSFHNGNMRVTAPGDSAEAMTIQYKMMHDA
YARMHQALLKTGRPIVYSLCQYGFDSVWQWGPEVGANLWRTTDDVNATFNSIALIGRDQA
GLSRYAGPGHWNDPDMLEVGNGKLTLDENRTHMGLWSMLAAPLLAGNNLSELTPEITAIL
TNREILAIDQDKLGHQADRIYAEGPIEIWARPLADGSRALAIFNFGEQRSYLRGISLHLR
EAGAADGWHARDIWAAKDLGPITDKMPLTIPRHGSIVLRLTH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgtttctccggaccatcacctcgctcctcctcttcgcacccttgctccccatg
cacgcccagcagaccgccaagcttgccgccactccgcccatgggttggaactcctggaac
tggttcgccggcaaggtcacggacaaagacgtccgccaggccgccgacctcctcgtctcc
tccggcatgcgcgacgccggatacgtctacgtcaacatagacgacacctgggaaggtaag
cgcgactccaccggcgtcctccacaccaacgagaaatttccggacatgaaggcactcgcc
gactacgtccacagcaaaggcctcaagctcggcatctacagctcccccggctcccagacc
tgcgcccgctttgaaggcagcttcggccacgagcagcaggatgcagacctctacgcctcc
tggggcatcgactacctcaaatacgatctctgcagcttccacaacggcaacatgcgcgtc
accgcccccggcgatagcgccgaagccatgaccatccaatacaaaatgatgcatgacgcc
tacgcgagaatgcaccaggccctcctcaagaccggccgccccatcgtctacagcctctgc
cagtacggctttgactccgtctggcagtggggcccggaggtcggtgccaatctctggcgc
accaccgacgacgtcaacgccaccttcaacagcatcgccctcatcggtcgagatcaggcc
ggcctctcccgctacgcaggccccggccactggaacgaccccgacatgcttgaagtcggc
aacggcaagctcaccctggacgagaaccgcacccacatgggtctctggtccatgctcgca
gcacccctgctcgccggcaacaacctcagcgagcttacccctgagatcaccgccattctc
accaatcgcgagatcctcgccatcgatcaggacaaactcggtcatcaggccgatcgcatc
tacgcagagggccccatcgagatctgggcacgtccactcgcggacggcagccgcgccctc
gccatcttcaacttcggcgagcagcgttcctacctccgcggcatctccctccacctccgt
gaagcaggcgcagccgacggctggcacgcacgcgacatctgggctgccaaagacctcggc
cccatcaccgacaagatgcccctcaccatcccccgtcacggctccatcgtcctccgcctg
acccactaa

DBGET integrated database retrieval system