KEGG   Granulicella tundricola: AciX9_1786Help
Entry
AciX9_1786        CDS       T01411                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
acm  Granulicella tundricola
Pathway
acm00260  Glycine, serine and threonine metabolism
acm00750  Vitamin B6 metabolism
acm01100  Metabolic pathways
acm01110  Biosynthesis of secondary metabolites
acm01120  Microbial metabolism in diverse environments
acm01230  Biosynthesis of amino acids
Module
acm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciX9_1786
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AciX9_1786
Enzymes [BR:acm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AciX9_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADW68834
UniProt: E8WZE6
Position
2079527..2080921
Genome map
AA seq 464 aa AA seqDB search
MIESHKLRCTGCATEISGPNAPSDFRCPLCKNLYEVIYPWSIKGTQKEGVAAASLPNASA
LRWLWQERRTSTMPVDQSGVWRFRDLLPIVTDMNKVTTLREGNTPLYELPKSAKALGLHW
VLAKHQGMNPTGSFKDTGMTAALSVAVERGFEWVACASTGNTSAAMAAYAARAGLRSIVF
IPEGKIAWGKLSQSMDYGALTVQLKTDFDGCVRLVNELVRAYPIYLLNSVNPYRLEGQKT
PAFELLEQLEWQVPEHVIAPGGNLANASALAKGFAEAHQLGLIPRIPKISIIQAQDANPL
YTFMHQPGGTDGRELIPVTAETRASAIRIGNPASWRKAVNALQTTGGWCEEVTEQEIALA
KAQIGAEGIGCEPASAVTLAGLKKLVADGRVKEKDRAVLILTGHTLKDSDYTIQYHRNEL
FTNQETAALTPEEAAQHTHLRKPPIVLEANRETVLSALEAQMKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagtcacacaagcttagatgcacaggatgcgctaccgagatctccggcccaaat
gcccccagcgacttccgctgcccgctctgcaaaaacctctatgaagtcatttatccctgg
tcgatcaaaggtactcagaaggaaggcgtagcagccgcatccctccccaacgcctcagcc
ctccgctggctctggcaggagcgccgcacctccaccatgcccgtagaccagtccggcgta
tggcgcttccgtgacctcctccccatcgtcacggacatgaacaaggtcacgacgctgcga
gagggcaacacccccctctacgaacttcccaagtccgccaaagcccttggcctccactgg
gtcctcgccaagcaccagggcatgaaccccaccggctccttcaaggacaccggcatgacc
gccgccctctccgttgcggtcgagcgaggctttgagtgggtcgcctgcgccagcaccggt
aacacctccgccgccatggccgcctacgccgcccgcgccggcctccgctccatcgtcttc
atccctgagggcaagatcgcctggggcaagctctcccagtccatggactacggagccctc
accgtccagctcaaaacagacttcgacggctgcgtccgcctcgtgaacgagctcgtccgc
gcctaccccatctatctcctcaactcggtcaacccctaccgcctggaaggtcagaagacc
cccgccttcgagctcctggagcaactggagtggcaggtccccgagcacgtcatcgccccc
ggcggcaacctcgccaacgccagcgccttggcaaagggcttcgcggaagcccatcaacta
ggcctcatcccccgcatcccaaagatctccatcatccaggcccaggacgccaaccctctc
tacaccttcatgcaccaacccggcggcacagacggcagggaactgatccccgtcaccgcg
gagacccgagcctccgccatccgcatcggcaaccccgcctcctggcgcaaggccgtcaac
gccctccagaccaccggaggctggtgtgaagaggtcaccgagcaggagatagccctcgcc
aaagcccagatcggtgccgaaggcataggctgcgagccagcctcagcagtcaccctggca
ggcctgaagaagctggtagcggatggtcgagtcaaagaaaaagaccgcgccgtgttgatc
ctcacaggccacaccctcaaggactccgactacaccatccaataccaccgcaacgagctc
ttcaccaaccaggaaaccgccgccctaaccccagaagaagccgcccaacacacccacctc
cgcaaaccccccatagtcctcgaagccaaccgcgaaacagtcctctccgccctcgaagcg
caaatgaaggcgtaa

DBGET integrated database retrieval system