KEGG   Granulicella tundricola: AciX9_2150Help
Entry
AciX9_2150        CDS       T01411                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
acm  Granulicella tundricola
Pathway
acm00790  Folate biosynthesis
acm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AciX9_2150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acm04147]
    AciX9_2150
Enzymes [BR:acm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AciX9_2150
Exosome [BR:acm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AciX9_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ADW69194
UniProt: E8X2H0
Position
2519375..2519659
Genome map
AA seq 94 aa AA seqDB search
MAVLSKAELDELLEKQQGWELQDGKLVREWRFRDFVEAMKFVDFVAEVAEEAGHHPDIDI
RYNKVKLGLVTHDEGGISSKDADMAARLGARFDI
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgctgagcaaagctgaactggatgagctgctggagaagcagcagggttgggag
ctgcaggatgggaagctggtgcgggagtggcggttccgggacttcgtggaggcgatgaag
ttcgtcgattttgtggcggaggttgcggaggaggctggtcatcatccggatatcgatatt
cgctacaacaaggtaaagctgggtctggtgacgcatgatgagggcggaatcagctccaaa
gatgccgacatggctgctcgtctgggtgcccggttcgatatctga

DBGET integrated database retrieval system