KEGG   Granulicella tundricola: AciX9_2289Help
Entry
AciX9_2289        CDS       T01411                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
acm  Granulicella tundricola
Pathway
acm00790  Folate biosynthesis
acm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AciX9_2289
Enzymes [BR:acm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AciX9_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: ADW69327
UniProt: E8X3P9
Position
complement(2677692..2678282)
Genome map
AA seq 196 aa AA seqDB search
MSEQNQTLASASTQDLYREMIRRMGEDPDRDGLLRTPERMEKSTAFLTQGYKQTVTEVLH
NALFDVDYDEMVIVKDIEFYSQCEHHLLPFFGKAHVAYVPNGKVIGLSKIARLVDVFARR
LQVQERLTRQIAESIEEAIAPQGVGIILEAQHLCMMMRGVEKQHSHTVTSAMLGVFKTQL
QTRNEFLSLVRHKTTL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacagaaccagaccctcgcatccgcatcgacgcaagacctctaccgcgagatg
atccgccgcatgggcgaagaccctgaccgcgacggccttctccgcactccggagcgcatg
gagaagtccaccgccttcctcacccagggctataaacagaccgtcacagaggtcctccac
aacgccctcttcgacgtcgactacgacgagatggtcatcgtcaaagacatcgagttctat
tcccagtgcgagcaccatctcctgcccttcttcggcaaggcccacgtcgcctacgtcccc
aacggtaaggtcatcggtctcagcaagatcgcacgcctcgtcgacgtcttcgcccgccgc
ctgcaagtccaggagcgcctcacccgccagatcgccgagtccatcgaagaggccatcgcc
ccccagggcgtaggcatcatccttgaagcccagcacctctgcatgatgatgcgcggcgta
gaaaaacagcactcccacaccgtcacctccgccatgctgggcgtcttcaaaacccaactc
caaacccgtaacgagtttctctcgctggtccgccataaaacgaccctctag

DBGET integrated database retrieval system