KEGG   Granulicella tundricola: AciX9_2525Help
Entry
AciX9_2525        CDS       T01411                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acm  Granulicella tundricola
Pathway
acm00010  Glycolysis / Gluconeogenesis
acm00051  Fructose and mannose metabolism
acm00562  Inositol phosphate metabolism
acm01100  Metabolic pathways
acm01110  Biosynthesis of secondary metabolites
acm01120  Microbial metabolism in diverse environments
acm01130  Biosynthesis of antibiotics
acm01200  Carbon metabolism
acm01230  Biosynthesis of amino acids
Module
acm_M00002  Glycolysis, core module involving three-carbon compounds
acm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX9_2525
   00051 Fructose and mannose metabolism
    AciX9_2525
   00562 Inositol phosphate metabolism
    AciX9_2525
Enzymes [BR:acm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AciX9_2525
Exosome [BR:acm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AciX9_2525
  Exosomal proteins of bladder cancer cells
   AciX9_2525
  Exosomal proteins of melanoma cells
   AciX9_2525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADW69555
UniProt: E8WVM6
Position
2955757..2956557
Genome map
AA seq 266 aa AA seqDB search
MKTEIRQKFIVGNWKMHTTSFEAQQLAKGIVDGLAAPDHVTVVLCPPFPYLPIVGDMLRG
SRVALGAQNVYPETEGAFTGEVSPNMLLDLDCKYVIVGHSERRHKLGESEAFINRKVKCA
LDSGLDVILCVGETLEQRQGGRTEAVLDHQLSTGLDGVSSDMLSHLSVAYEPVWAIGNDE
HHATPQQAHDTHVLIRRKLTQILGATWSEELSVHYGGSVEPGNAAAFLGQDGIDGVLIGG
ASLKADEFLAIVNAGICETEAEMQTA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggaaatccgccagaaattcattgttgggaactggaagatgcacacgacctca
ttcgaagcccagcaactcgccaagggcatagttgatggcttggccgcgccggaccacgtc
acagtagtcctctgcccaccgttcccgtaccttccgatcgttggagacatgctcaggggt
agccgggtcgcgcttggcgcgcagaatgtttacccggaaaccgaaggcgccttcaccggc
gaggtgagcccgaacatgttgctcgatctcgactgcaaatacgtcatcgtgggacatagt
gagcgcagacacaagctaggcgaatccgaagcttttatcaatcgtaaagtgaagtgtgcg
ctcgattcaggtttggacgtgatcctttgcgtgggcgagactctagagcagcgacaaggc
ggacggacggaggcggtactcgatcatcagctcagcaccggattggatggagtatcgtcc
gatatgttgtctcacctcagcgtcgcctacgaaccagtgtgggcgatcggcaacgacgaa
catcatgcaactcctcaacaggcgcatgatacgcatgtgctcattcggagaaaactcact
cagatacttggggcgacgtggtccgaggagctatcggtccattacggtggcagcgttgaa
ccggggaatgcagccgcgtttttgggtcaggacggcatcgacggtgttctgattggcggt
gccagtctgaaggccgatgagtttctcgccatcgtcaatgcgggtatttgtgaaacagaa
gcggaaatgcagaccgcgtga

DBGET integrated database retrieval system